277465

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 53911..54446 Replicon plasmid unnamed4
Accession NZ_CP122638
Organism Escherichia coli strain ETEC4085

Toxin (Protein)


Gene name relE Uniprot ID Q60228
Locus tag QDW62_RS27770 Protein ID WP_001270417.1
Coordinates 54159..54446 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag QDW62_RS27765 Protein ID WP_001132895.1
Coordinates 53911..54162 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW62_RS27740 (48933) 48933..50120 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDW62_RS27745 (50389) 50389..50754 - 366 Protein_58 transposase DNA-binding-containing protein -
QDW62_RS27750 (50988) 50988..51950 - 963 WP_000756327.1 ParB family protein -
QDW62_RS27755 (51947) 51947..53152 - 1206 WP_000817634.1 AAA family ATPase -
QDW62_RS27760 (53526) 53526..53738 + 213 WP_000402944.1 hypothetical protein -
QDW62_RS27765 (53911) 53911..54162 + 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDW62_RS27770 (54159) 54159..54446 + 288 WP_001270417.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW62_RS27775 (54448) 54448..54693 + 246 Protein_64 integrase core domain-containing protein -
QDW62_RS27780 (55373) 55373..56350 + 978 WP_000361610.1 RepB family plasmid replication initiator protein -
QDW62_RS27785 (56635) 56635..57375 - 741 WP_001066942.1 tyrosine-type recombinase/integrase -
QDW62_RS27790 (57738) 57738..58032 - 295 Protein_67 type II toxin-antitoxin system RelE/ParE family toxin -
QDW62_RS27795 (58019) 58019..58269 - 251 Protein_68 type II toxin-antitoxin system ParD family antitoxin -
QDW62_RS27800 (58792) 58792..58901 - 110 Protein_69 IS5/IS1182 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeC / faeD / faeE / faeF / faeG / faeH / faeI / faeJ / eltA 1..106966 106966
- inside IScluster/Tn - eltA 23099..54693 31594


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11214.24 Da        Isoelectric Point: 10.4703

>T277465 WP_001270417.1 NZ_CP122638:54159-54446 [Escherichia coli]
MRYQVKFREDALKEWQKLDKAIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT277465 WP_001132895.1 NZ_CP122638:53911-54162 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T8BSB4

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References