Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 10952..11709 | Replicon | plasmid unnamed4 |
Accession | NZ_CP122638 | ||
Organism | Escherichia coli strain ETEC4085 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A0L6ZF90 |
Locus tag | QDW62_RS27515 | Protein ID | WP_000501972.1 |
Coordinates | 11224..11709 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | QDW62_RS27510 | Protein ID | WP_072141942.1 |
Coordinates | 10952..11236 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW62_RS27475 (6797) | 6797..7081 | + | 285 | WP_001398227.1 | hypothetical protein | - |
QDW62_RS27480 (7187) | 7187..8182 | + | 996 | WP_063109503.1 | hypothetical protein | - |
QDW62_RS27485 (8253) | 8253..8381 | + | 129 | Protein_6 | Hok/Gef family protein | - |
QDW62_RS27490 (8626) | 8626..8886 | + | 261 | WP_000083819.1 | replication regulatory protein RepA | - |
QDW62_RS27495 (9111) | 9111..9185 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
QDW62_RS27500 (9178) | 9178..10035 | + | 858 | WP_000130999.1 | incFII family plasmid replication initiator RepA | - |
QDW62_RS27505 (10737) | 10737..10877 | + | 141 | WP_021503378.1 | hypothetical protein | - |
QDW62_RS27510 (10952) | 10952..11236 | + | 285 | WP_072141942.1 | DUF1778 domain-containing protein | Antitoxin |
QDW62_RS27515 (11224) | 11224..11709 | + | 486 | WP_000501972.1 | GNAT family N-acetyltransferase | Toxin |
QDW62_RS27520 (12035) | 12035..13222 | - | 1188 | WP_000937614.1 | IS91-like element IS91 family transposase | - |
QDW62_RS27525 (13222) | 13222..13587 | - | 366 | WP_000124098.1 | hypothetical protein | - |
QDW62_RS27535 (14675) | 14675..15019 | + | 345 | WP_272482423.1 | adhesin biosynthesis transcription regulatory family protein | - |
QDW62_RS27540 (15019) | 15019..15564 | + | 546 | WP_236295085.1 | K88 fimbrial protein FaeC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | faeC / faeD / faeE / faeF / faeG / faeH / faeI / faeJ / eltA | 1..106966 | 106966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17630.39 Da Isoelectric Point: 9.9107
>T277464 WP_000501972.1 NZ_CP122638:11224-11709 [Escherichia coli]
MGCVTAPEPLSSFHQVAEFVSGEAVLDDWLKQKGLKNQALGATRTFVVCRKGTQQVVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDASFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTESAKQFYIHHGFTPSKTQLQTLFLKLP
Q
MGCVTAPEPLSSFHQVAEFVSGEAVLDDWLKQKGLKNQALGATRTFVVCRKGTQQVVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDASFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTESAKQFYIHHGFTPSKTQLQTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|