277460

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 41219..41793 Replicon plasmid unnamed2
Accession NZ_CP122636
Organism Escherichia coli strain ETEC4085

Toxin (Protein)


Gene name vapC Uniprot ID A0A3A6SGD2
Locus tag QDW62_RS26365 Protein ID WP_000604346.1
Coordinates 41219..41593 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A3A6S782
Locus tag QDW62_RS26370 Protein ID WP_001261052.1
Coordinates 41590..41793 (-) Length 68 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW62_RS26340 (QDW62_26340) 37255..37524 - 270 Protein_46 transposase zinc-binding domain-containing protein -
QDW62_RS26345 (QDW62_26345) 37843..38496 + 654 WP_011117027.1 serine protease -
QDW62_RS26350 (QDW62_26350) 38593..38958 + 366 WP_000124098.1 hypothetical protein -
QDW62_RS26355 (QDW62_26355) 38958..40145 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDW62_RS26360 (QDW62_26360) 40480..41037 + 558 WP_000735639.1 Ail/Lom family outer membrane beta-barrel protein -
QDW62_RS26365 (QDW62_26365) 41219..41593 - 375 WP_000604346.1 PIN domain-containing protein Toxin
QDW62_RS26370 (QDW62_26370) 41590..41793 - 204 WP_001261052.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDW62_RS26375 (QDW62_26375) 41897..43909 - 2013 WP_000635641.1 relaxase/mobilization nuclease domain-containing protein -
QDW62_RS26380 (QDW62_26380) 43915..44250 - 336 WP_000045231.1 plasmid mobilization protein MobA -
QDW62_RS26385 (QDW62_26385) 45450..45620 + 171 WP_071881852.1 helix-turn-helix domain-containing protein -
QDW62_RS26390 (QDW62_26390) 45665..46295 - 631 Protein_56 DUF4942 domain-containing protein -
QDW62_RS26395 (QDW62_26395) 46350..46607 - 258 WP_000174705.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(4)-Ia / sul2 / aph(3'')-Ib / blaTEM-1C hlyD / hlyB / hlyA / hlyC 1..129439 129439


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-114)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-44)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13911.31 Da        Isoelectric Point: 6.9672

>T277460 WP_000604346.1 NZ_CP122636:c41593-41219 [Escherichia coli]
MILVDTSVWVDHFKNKNDTLIQLLQSDFVLMHPMILAEIACGTPPAPRQRTLSDLDLLPKSHQATITEVLAFIENEKLFG
LGCGLVDITLLASTRITPGAKIWTLDKRLSRLAKHLNVEYQPVH

Download         Length: 375 bp

Antitoxin


Download         Length: 68 a.a.        Molecular weight: 7366.47 Da        Isoelectric Point: 6.2644

>AT277460 WP_001261052.1 NZ_CP122636:c41793-41590 [Escherichia coli]
MRTTVTIDDVLYAQALEMADPGMDKSDIFREAVKTFIRVQAAKRLASLGGAAPNMEITPRRRGDVAE

Download         Length: 204 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3A6SGD2

Antitoxin

Source ID Structure
AlphaFold DB A0A3A6S782

References