Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3206425..3207259 Replicon chromosome
Accession NZ_CP122634
Organism Escherichia coli strain ETEC4085

Toxin (Protein)


Gene name yeeV Uniprot ID W0S379
Locus tag QDW62_RS16195 Protein ID WP_000854808.1
Coordinates 3206425..3206802 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID W0S4A5
Locus tag QDW62_RS16200 Protein ID WP_001285114.1
Coordinates 3206891..3207259 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW62_RS16155 (3201432) 3201432..3201923 - 492 WP_001300785.1 DUF1097 domain-containing protein -
QDW62_RS16160 (3202025) 3202025..3202579 - 555 WP_001001902.1 molecular chaperone YcdY -
QDW62_RS16165 (3202603) 3202603..3203340 - 738 WP_000283664.1 zinc-binding phosphatase -
QDW62_RS16170 (3203395) 3203395..3204333 - 939 WP_000351315.1 glyoxylate/hydroxypyruvate reductase GhrA -
QDW62_RS16180 (3204804) 3204804..3205646 - 843 WP_001280436.1 DUF4942 domain-containing protein -
QDW62_RS16185 (3205731) 3205731..3205928 - 198 WP_000839248.1 DUF957 domain-containing protein -
QDW62_RS16190 (3205940) 3205940..3206428 - 489 WP_000761657.1 DUF5983 family protein -
QDW62_RS16195 (3206425) 3206425..3206802 - 378 WP_000854808.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW62_RS16200 (3206891) 3206891..3207259 - 369 WP_001285114.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW62_RS16205 (3207309) 3207309..3207956 - 648 WP_000094919.1 hypothetical protein -
QDW62_RS16210 (3207975) 3207975..3208196 - 222 WP_000692345.1 DUF987 domain-containing protein -
QDW62_RS16215 (3208265) 3208265..3208741 - 477 WP_001186747.1 RadC family protein -
QDW62_RS16220 (3208757) 3208757..3209242 - 486 WP_000214416.1 antirestriction protein -
QDW62_RS16225 (3209334) 3209334..3210152 - 819 WP_001234743.1 DUF932 domain-containing protein -
QDW62_RS16230 (3210245) 3210245..3210423 + 179 Protein_3175 hypothetical protein -
QDW62_RS16235 (3210563) 3210563..3210976 - 414 WP_000789535.1 hypothetical protein -
QDW62_RS16240 (3211246) 3211246..3211785 - 540 WP_001104020.1 DUF4339 domain-containing protein -
QDW62_RS16245 (3211910) 3211910..3212083 - 174 WP_001370911.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG 3197813..3209242 11429


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13909.93 Da        Isoelectric Point: 7.9085

>T277454 WP_000854808.1 NZ_CP122634:c3206802-3206425 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13767.60 Da        Isoelectric Point: 6.9460

>AT277454 WP_001285114.1 NZ_CP122634:c3207259-3206891 [Escherichia coli]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W0S379

Antitoxin

Source ID Structure
AlphaFold DB W0S4A5

References