Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1987204..1988036 | Replicon | chromosome |
| Accession | NZ_CP122634 | ||
| Organism | Escherichia coli strain ETEC4085 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | QDW62_RS09745 | Protein ID | WP_000854765.1 |
| Coordinates | 1987204..1987578 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8S7UAZ9 |
| Locus tag | QDW62_RS09750 | Protein ID | WP_001372808.1 |
| Coordinates | 1987668..1988036 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW62_RS09710 (1982663) | 1982663..1982992 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QDW62_RS09715 (1983093) | 1983093..1983359 | - | 267 | WP_001360325.1 | EutP/PduV family microcompartment system protein | - |
| QDW62_RS09720 (1983549) | 1983549..1984331 | - | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| QDW62_RS09725 (1984328) | 1984328..1985350 | - | 1023 | WP_001372384.1 | IS21-like element IS100 family transposase | - |
| QDW62_RS09730 (1985688) | 1985688..1986077 | - | 390 | WP_077249349.1 | transposase | - |
| QDW62_RS09735 (1986875) | 1986875..1986955 | - | 81 | Protein_1905 | hypothetical protein | - |
| QDW62_RS09740 (1987055) | 1987055..1987207 | - | 153 | Protein_1906 | DUF5983 family protein | - |
| QDW62_RS09745 (1987204) | 1987204..1987578 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| QDW62_RS09750 (1987668) | 1987668..1988036 | - | 369 | WP_001372808.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW62_RS09755 (1988199) | 1988199..1988420 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QDW62_RS09760 (1988489) | 1988489..1988965 | - | 477 | WP_001186770.1 | RadC family protein | - |
| QDW62_RS09765 (1988981) | 1988981..1989454 | - | 474 | WP_001372806.1 | antirestriction protein | - |
| QDW62_RS09770 (1989796) | 1989796..1990614 | - | 819 | WP_001234651.1 | DUF932 domain-containing protein | - |
| QDW62_RS09775 (1990732) | 1990732..1990927 | - | 196 | Protein_1913 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1987204..2004044 | 16840 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T277444 WP_000854765.1 NZ_CP122634:c1987578-1987204 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13551.25 Da Isoelectric Point: 5.4492
>AT277444 WP_001372808.1 NZ_CP122634:c1988036-1987668 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGTRLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGTRLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|