Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1064233..1064816 | Replicon | chromosome |
| Accession | NZ_CP122634 | ||
| Organism | Escherichia coli strain ETEC4085 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | QDW62_RS05195 | Protein ID | WP_000254738.1 |
| Coordinates | 1064481..1064816 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | QDW62_RS05190 | Protein ID | WP_000581937.1 |
| Coordinates | 1064233..1064481 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW62_RS05180 (1060572) | 1060572..1061873 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| QDW62_RS05185 (1061921) | 1061921..1064155 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| QDW62_RS05190 (1064233) | 1064233..1064481 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QDW62_RS05195 (1064481) | 1064481..1064816 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| QDW62_RS05200 (1064887) | 1064887..1065678 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| QDW62_RS05205 (1065906) | 1065906..1067543 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| QDW62_RS05210 (1067631) | 1067631..1068929 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T277443 WP_000254738.1 NZ_CP122634:1064481-1064816 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|