Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 807070..807905 Replicon chromosome
Accession NZ_CP122634
Organism Escherichia coli strain ETEC4085

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1V1GYU4
Locus tag QDW62_RS03945 Protein ID WP_000854719.1
Coordinates 807070..807447 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QDW62_RS03950 Protein ID WP_001285113.1
Coordinates 807537..807905 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW62_RS03915 (803146) 803146..803682 + 537 WP_000942783.1 GspM family type II secretion system protein YghD -
QDW62_RS03920 (804036) 804036..804983 - 948 WP_001440173.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QDW62_RS03925 (804976) 804976..805371 - 396 WP_000208386.1 DUF6088 family protein -
QDW62_RS03930 (805440) 805440..806285 - 846 WP_001440175.1 DUF4942 domain-containing protein -
QDW62_RS03935 (806370) 806370..806567 - 198 WP_000839266.1 DUF957 domain-containing protein -
QDW62_RS03940 (806585) 806585..807073 - 489 WP_000761679.1 DUF5983 family protein -
QDW62_RS03945 (807070) 807070..807447 - 378 WP_000854719.1 TA system toxin CbtA family protein Toxin
QDW62_RS03950 (807537) 807537..807905 - 369 WP_001285113.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW62_RS03955 (807955) 807955..808599 - 645 WP_000086770.1 hypothetical protein -
QDW62_RS03960 (808618) 808618..808839 - 222 WP_000692345.1 DUF987 domain-containing protein -
QDW62_RS03965 (808908) 808908..809384 - 477 WP_001186715.1 RadC family protein -
QDW62_RS03970 (809400) 809400..809885 - 486 WP_000213705.1 antirestriction protein -
QDW62_RS03975 (809962) 809962..810780 - 819 WP_021529747.1 DUF932 domain-containing protein -
QDW62_RS03980 (810870) 810870..811103 - 234 WP_001278283.1 DUF905 family protein -
QDW62_RS03985 (811109) 811109..811786 - 678 WP_001097369.1 hypothetical protein -
QDW62_RS03990 (811905) 811905..812789 - 885 WP_000010398.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 804976..852154 47178
- inside Genomic island - - 804976..848809 43833


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14059.10 Da        Isoelectric Point: 8.2904

>T277441 WP_000854719.1 NZ_CP122634:c807447-807070 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13693.33 Da        Isoelectric Point: 5.4970

>AT277441 WP_001285113.1 NZ_CP122634:c807905-807537 [Escherichia coli]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTSETKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V1GYU4

Antitoxin

Source ID Structure

References