Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 131453..131988 Replicon plasmid unnamed4
Accession NZ_CP122633
Organism Escherichia coli strain ETEC4088

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag QDW58_RS25505 Protein ID WP_000222766.1
Coordinates 131701..131988 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag QDW58_RS25500 Protein ID WP_001132900.1
Coordinates 131453..131704 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW58_RS25455 (126580) 126580..127140 + 561 WP_000139315.1 fertility inhibition protein FinO -
QDW58_RS25460 (127276) 127276..127488 + 213 WP_001299730.1 ANR family transcriptional regulator -
QDW58_RS25465 (127734) 127734..127808 + 75 Protein_125 endonuclease -
- (128064) 128064..128125 - 62 NuclAT_1 - -
- (128064) 128064..128125 - 62 NuclAT_1 - -
- (128064) 128064..128125 - 62 NuclAT_1 - -
- (128064) 128064..128125 - 62 NuclAT_1 - -
QDW58_RS25470 (128169) 128169..128318 + 150 WP_001312851.1 Hok/Gef family protein -
QDW58_RS25475 (128602) 128602..128859 + 258 WP_000083845.1 replication regulatory protein RepA -
QDW58_RS25480 (128876) 128876..129127 - 252 WP_223195197.1 replication protein RepA -
QDW58_RS25485 (129118) 129118..129165 + 48 WP_229471593.1 hypothetical protein -
QDW58_RS25490 (129158) 129158..129640 + 483 WP_001273588.1 hypothetical protein -
QDW58_RS25495 (129633) 129633..130490 + 858 WP_098723225.1 incFII family plasmid replication initiator RepA -
QDW58_RS25500 (131453) 131453..131704 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDW58_RS25505 (131701) 131701..131988 + 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW58_RS25510 (132257) 132257..132751 - 495 Protein_134 IS3 family transposase -
QDW58_RS25515 (132941) 132941..134518 - 1578 WP_098723224.1 PAS domain-containing methyl-accepting chemotaxis protein -
QDW58_RS25520 (134828) 134828..135388 + 561 WP_001161490.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..139741 139741


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T277437 WP_000222766.1 NZ_CP122633:131701-131988 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT277437 WP_001132900.1 NZ_CP122633:131453-131704 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References