Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 118815..119440 | Replicon | plasmid unnamed4 |
Accession | NZ_CP122633 | ||
Organism | Escherichia coli strain ETEC4088 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDW58_RS25430 | Protein ID | WP_000911333.1 |
Coordinates | 118815..119213 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | QDW58_RS25435 | Protein ID | WP_000450520.1 |
Coordinates | 119213..119440 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW58_RS25415 (115146) | 115146..115655 | + | 510 | WP_000628107.1 | conjugal transfer entry exclusion protein TraS | - |
QDW58_RS25420 (115669) | 115669..116400 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
QDW58_RS25425 (116653) | 116653..118806 | + | 2154 | WP_000009325.1 | type IV conjugative transfer system coupling protein TraD | - |
QDW58_RS25430 (118815) | 118815..119213 | - | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QDW58_RS25435 (119213) | 119213..119440 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..139741 | 139741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T277436 WP_000911333.1 NZ_CP122633:c119213-118815 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|