Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 14259..14902 Replicon plasmid unnamed4
Accession NZ_CP122633
Organism Escherichia coli strain ETEC4088

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QDW58_RS24885 Protein ID WP_001034044.1
Coordinates 14259..14675 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QDW58_RS24890 Protein ID WP_001261286.1
Coordinates 14672..14902 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW58_RS24870 (10890) 10890..11587 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
QDW58_RS24875 (11612) 11612..12634 - 1023 WP_000361402.1 helicase UvrD -
QDW58_RS24880 (12619) 12619..14184 - 1566 WP_001128474.1 AAA family ATPase -
QDW58_RS24885 (14259) 14259..14675 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QDW58_RS24890 (14672) 14672..14902 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDW58_RS24895 (15506) 15506..15856 + 351 WP_000493379.1 hypothetical protein -
QDW58_RS24900 (15900) 15900..16589 + 690 WP_000796228.1 hypothetical protein -
QDW58_RS24905 (16586) 16586..17377 + 792 WP_000016494.1 site-specific integrase -
QDW58_RS24910 (17555) 17555..17908 + 354 WP_000864812.1 colicin M immunity protein -
QDW58_RS24915 (17958) 17958..18773 - 816 WP_001312845.1 lipid II-degrading bacteriocin colicin M -
QDW58_RS24920 (19017) 19017..19544 + 528 WP_000203272.1 colicin B immunity protein -
QDW58_RS24925 (19562) 19562..19729 - 168 Protein_17 colicin-B -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..139741 139741


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T277431 WP_001034044.1 NZ_CP122633:c14675-14259 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT277431 WP_001261286.1 NZ_CP122633:c14902-14672 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References