Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4396294..4396889 | Replicon | chromosome |
| Accession | NZ_CP122629 | ||
| Organism | Escherichia coli strain ETEC4088 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | QDW58_RS21405 | Protein ID | WP_000239579.1 |
| Coordinates | 4396294..4396644 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | QDW58_RS21410 | Protein ID | WP_001223208.1 |
| Coordinates | 4396638..4396889 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW58_RS21385 (4391570) | 4391570..4392592 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
| QDW58_RS21390 (4392606) | 4392606..4394108 | - | 1503 | WP_000205794.1 | sugar ABC transporter ATP-binding protein | - |
| QDW58_RS21395 (4394418) | 4394418..4395374 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| QDW58_RS21400 (4395684) | 4395684..4396214 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
| QDW58_RS21405 (4396294) | 4396294..4396644 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| QDW58_RS21410 (4396638) | 4396638..4396889 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| QDW58_RS21415 (4397101) | 4397101..4397442 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| QDW58_RS21420 (4397445) | 4397445..4401215 | - | 3771 | WP_282834280.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T277423 WP_000239579.1 NZ_CP122629:c4396644-4396294 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |