Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3732283..3733120 | Replicon | chromosome |
Accession | NZ_CP122629 | ||
Organism | Escherichia coli strain ETEC4088 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QDW58_RS18285 | Protein ID | WP_000227784.1 |
Coordinates | 3732578..3733120 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QDW58_RS18280 | Protein ID | WP_001297137.1 |
Coordinates | 3732283..3732594 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW58_RS18255 (3727303) | 3727303..3728250 | + | 948 | WP_098723158.1 | cytochrome o ubiquinol oxidase subunit II | - |
QDW58_RS18260 (3728272) | 3728272..3730263 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QDW58_RS18265 (3730253) | 3730253..3730867 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QDW58_RS18270 (3730867) | 3730867..3731196 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QDW58_RS18275 (3731208) | 3731208..3732098 | + | 891 | WP_000971336.1 | heme o synthase | - |
QDW58_RS18280 (3732283) | 3732283..3732594 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QDW58_RS18285 (3732578) | 3732578..3733120 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QDW58_RS18290 (3733176) | 3733176..3734111 | - | 936 | WP_001365761.1 | tetratricopeptide repeat protein | - |
QDW58_RS18295 (3734519) | 3734519..3735883 | + | 1365 | WP_001000974.1 | MFS transporter | - |
QDW58_RS18300 (3736011) | 3736011..3736502 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QDW58_RS18305 (3736670) | 3736670..3737581 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T277421 WP_000227784.1 NZ_CP122629:3732578-3733120 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|