Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3698206..3698824 | Replicon | chromosome |
Accession | NZ_CP122629 | ||
Organism | Escherichia coli strain ETEC4088 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDW58_RS18115 | Protein ID | WP_001291435.1 |
Coordinates | 3698606..3698824 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDW58_RS18110 | Protein ID | WP_000344800.1 |
Coordinates | 3698206..3698580 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW58_RS18100 (3693295) | 3693295..3694488 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDW58_RS18105 (3694511) | 3694511..3697660 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QDW58_RS18110 (3698206) | 3698206..3698580 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDW58_RS18115 (3698606) | 3698606..3698824 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDW58_RS18120 (3698995) | 3698995..3699546 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDW58_RS18125 (3699662) | 3699662..3700132 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDW58_RS18130 (3700296) | 3700296..3701846 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDW58_RS18135 (3701888) | 3701888..3702241 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
QDW58_RS18145 (3702620) | 3702620..3702931 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDW58_RS18150 (3702962) | 3702962..3703534 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277420 WP_001291435.1 NZ_CP122629:3698606-3698824 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277420 WP_000344800.1 NZ_CP122629:3698206-3698580 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |