Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2962184..2962985 | Replicon | chromosome |
| Accession | NZ_CP122629 | ||
| Organism | Escherichia coli strain ETEC4088 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2V687 |
| Locus tag | QDW58_RS14595 | Protein ID | WP_000854739.1 |
| Coordinates | 2962184..2962564 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P7R0L9 |
| Locus tag | QDW58_RS14600 | Protein ID | WP_001285482.1 |
| Coordinates | 2962611..2962985 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW58_RS14560 (2957775) | 2957775..2958329 | - | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
| QDW58_RS14565 (2958353) | 2958353..2959090 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QDW58_RS14570 (2959145) | 2959145..2960083 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDW58_RS14580 (2960554) | 2960554..2961397 | - | 844 | Protein_2858 | DUF4942 domain-containing protein | - |
| QDW58_RS14585 (2961482) | 2961482..2961679 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| QDW58_RS14590 (2961699) | 2961699..2962187 | - | 489 | WP_001054232.1 | DUF5983 family protein | - |
| QDW58_RS14595 (2962184) | 2962184..2962564 | - | 381 | WP_000854739.1 | TA system toxin CbtA family protein | Toxin |
| QDW58_RS14600 (2962611) | 2962611..2962985 | - | 375 | WP_001285482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW58_RS14605 (2963035) | 2963035..2963679 | - | 645 | WP_000086763.1 | hypothetical protein | - |
| QDW58_RS14610 (2963698) | 2963698..2963919 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| QDW58_RS14615 (2963982) | 2963982..2964458 | - | 477 | WP_001186170.1 | RadC family protein | - |
| QDW58_RS14620 (2964474) | 2964474..2964947 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| QDW58_RS14625 (2965211) | 2965211..2966032 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| QDW58_RS14630 (2966211) | 2966211..2966300 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| QDW58_RS14635 (2966443) | 2966443..2966898 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14214.14 Da Isoelectric Point: 6.4773
>T277419 WP_000854739.1 NZ_CP122629:c2962564-2962184 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13791.44 Da Isoelectric Point: 4.7511
>AT277419 WP_001285482.1 NZ_CP122629:c2962985-2962611 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V687 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7R0L9 |