Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2564264..2564902 | Replicon | chromosome |
Accession | NZ_CP122629 | ||
Organism | Escherichia coli strain ETEC4088 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDW58_RS12480 | Protein ID | WP_000813794.1 |
Coordinates | 2564726..2564902 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDW58_RS12475 | Protein ID | WP_001270286.1 |
Coordinates | 2564264..2564680 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW58_RS12455 (2559416) | 2559416..2560357 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
QDW58_RS12460 (2560358) | 2560358..2561371 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QDW58_RS12465 (2561389) | 2561389..2562534 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
QDW58_RS12470 (2562779) | 2562779..2564185 | - | 1407 | WP_282834223.1 | PLP-dependent aminotransferase family protein | - |
QDW58_RS12475 (2564264) | 2564264..2564680 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDW58_RS12480 (2564726) | 2564726..2564902 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDW58_RS12485 (2565124) | 2565124..2565354 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDW58_RS12490 (2565446) | 2565446..2567407 | - | 1962 | WP_001593323.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDW58_RS12495 (2567480) | 2567480..2568016 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QDW58_RS12500 (2568108) | 2568108..2569283 | + | 1176 | WP_247187089.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277418 WP_000813794.1 NZ_CP122629:c2564902-2564726 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277418 WP_001270286.1 NZ_CP122629:c2564680-2564264 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|