Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1358195..1358820 | Replicon | chromosome |
| Accession | NZ_CP122629 | ||
| Organism | Escherichia coli strain ETEC4088 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QDW58_RS06610 | Protein ID | WP_000911330.1 |
| Coordinates | 1358422..1358820 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | QDW58_RS06605 | Protein ID | WP_000450524.1 |
| Coordinates | 1358195..1358422 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW58_RS06580 (1353998) | 1353998..1354468 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| QDW58_RS06585 (1354468) | 1354468..1355040 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| QDW58_RS06590 (1355186) | 1355186..1356064 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| QDW58_RS06595 (1356081) | 1356081..1357115 | + | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
| QDW58_RS06600 (1357328) | 1357328..1358041 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| QDW58_RS06605 (1358195) | 1358195..1358422 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QDW58_RS06610 (1358422) | 1358422..1358820 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDW58_RS06615 (1358967) | 1358967..1359830 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| QDW58_RS06620 (1359845) | 1359845..1361860 | + | 2016 | WP_000829292.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| QDW58_RS06625 (1361934) | 1361934..1362632 | + | 699 | WP_000679812.1 | esterase | - |
| QDW58_RS06630 (1362713) | 1362713..1362913 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T277411 WP_000911330.1 NZ_CP122629:1358422-1358820 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|