Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | rnlAB/RnlA-RnlB |
Location | 1197674..1199210 | Replicon | chromosome |
Accession | NZ_CP122629 | ||
Organism | Escherichia coli strain ETEC4088 |
Toxin (Protein)
Gene name | rnlA | Uniprot ID | - |
Locus tag | QDW58_RS05845 | Protein ID | WP_001323629.1 |
Coordinates | 1197674..1198855 (+) | Length | 394 a.a. |
Antitoxin (Protein)
Gene name | rnlB | Uniprot ID | E6BSF0 |
Locus tag | QDW58_RS05850 | Protein ID | WP_000461705.1 |
Coordinates | 1198848..1199210 (+) | Length | 121 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW58_RS05830 (1193270) | 1193270..1196800 | + | 3531 | WP_072008905.1 | prophage tail fiber N-terminal domain-containing protein | - |
QDW58_RS05835 (1196800) | 1196800..1197384 | + | 585 | WP_137422147.1 | tail fiber assembly protein | - |
QDW58_RS05840 (1197454) | 1197454..1197650 | + | 197 | Protein_1141 | recombinase family protein | - |
QDW58_RS05845 (1197674) | 1197674..1198855 | + | 1182 | WP_001323629.1 | type II toxin-antitoxin system RnlA family toxin | Toxin |
QDW58_RS05850 (1198848) | 1198848..1199210 | + | 363 | WP_000461705.1 | type II toxin-antitoxin system RnlB family antitoxin | Antitoxin |
QDW58_RS05855 (1199348) | 1199348..1199617 | - | 270 | WP_000429347.1 | hypothetical protein | - |
QDW58_RS05865 (1200495) | 1200495..1200977 | - | 483 | WP_000162574.1 | SsrA-binding protein SmpB | - |
QDW58_RS05870 (1201148) | 1201148..1201585 | + | 438 | WP_196064406.1 | type II toxin-antitoxin system toxin RatA | - |
QDW58_RS05875 (1201575) | 1201575..1201865 | + | 291 | WP_001117838.1 | RnfH family protein | - |
QDW58_RS05880 (1201927) | 1201927..1202268 | - | 342 | WP_001203437.1 | outer membrane protein assembly factor BamE | - |
QDW58_RS05885 (1202417) | 1202417..1204078 | - | 1662 | WP_098723215.1 | DNA repair protein RecN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 394 a.a. Molecular weight: 44833.64 Da Isoelectric Point: 8.3036
>T277410 WP_001323629.1 NZ_CP122629:1197674-1198855 [Escherichia coli]
MAAGGILSVPDFRIQRLIRLKRGYIVEFAKFFYRVKQMTVRNYTNLNLDRTTIEATSRAFIENKNYSVHSIGPMPGARAG
LRVVFAKPGEALATVNIFYNNGGTSTVQYQTGANHNLGKELADDLYETINPAEFEQVNMVLQGFVEANVLSVLQLSAEQP
HIQFYEYLRNTHTTVWKIHSPEFQDELTVSLHHRNGTLQIQGRPLSCYRVFIFNLSELLDLQGLEKVLIRQDDGKAYIVQ
KEVARSHLECEMGDAYPLLHKNVEKLLVSGLCVKLAAPDLPDYCMLLYPELRSVEGVLKSTMYRYGMPITQDGFGRYFDK
IGSEFILKQQFGCNLSSAKVKTINDAYTFFNRERHGLFHMEIVVDTSRMVSDMARLMTKARQAWGIIKDLYIV
MAAGGILSVPDFRIQRLIRLKRGYIVEFAKFFYRVKQMTVRNYTNLNLDRTTIEATSRAFIENKNYSVHSIGPMPGARAG
LRVVFAKPGEALATVNIFYNNGGTSTVQYQTGANHNLGKELADDLYETINPAEFEQVNMVLQGFVEANVLSVLQLSAEQP
HIQFYEYLRNTHTTVWKIHSPEFQDELTVSLHHRNGTLQIQGRPLSCYRVFIFNLSELLDLQGLEKVLIRQDDGKAYIVQ
KEVARSHLECEMGDAYPLLHKNVEKLLVSGLCVKLAAPDLPDYCMLLYPELRSVEGVLKSTMYRYGMPITQDGFGRYFDK
IGSEFILKQQFGCNLSSAKVKTINDAYTFFNRERHGLFHMEIVVDTSRMVSDMARLMTKARQAWGIIKDLYIV
Download Length: 1182 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|