277403

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 20369..20834 Replicon plasmid unnamed1
Accession NZ_CP122626
Organism Escherichia coli strain ETEC4089

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag QDW64_RS23440 Protein ID WP_001230707.1
Coordinates 20369..20620 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag QDW64_RS23445 Protein ID WP_000801440.1
Coordinates 20607..20834 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW64_RS23410 (QDW64_23405) 15851..16378 - 528 WP_000577043.1 DUF2726 domain-containing protein -
QDW64_RS23415 (QDW64_23410) 16513..16917 - 405 WP_012421203.1 hypothetical protein -
QDW64_RS23420 (QDW64_23415) 16930..17166 - 237 WP_071699791.1 RepB family plasmid replication initiator protein -
QDW64_RS23425 (QDW64_23420) 17163..17711 - 549 WP_000729198.1 replication initiation protein -
QDW64_RS23430 (QDW64_23425) 19210..19725 + 516 WP_001025395.1 J domain-containing protein -
QDW64_RS23435 (QDW64_23430) 19830..20372 + 543 WP_001083906.1 hypothetical protein -
QDW64_RS23440 (QDW64_23435) 20369..20620 + 252 WP_001230707.1 hypothetical protein Toxin
QDW64_RS23445 (QDW64_23440) 20607..20834 + 228 WP_000801440.1 hypothetical protein Antitoxin
QDW64_RS23450 (QDW64_23445) 21288..21587 + 300 WP_000650309.1 hypothetical protein -
QDW64_RS23455 (QDW64_23450) 21678..22028 + 351 WP_000854259.1 hypothetical protein -
QDW64_RS23460 (QDW64_23455) 22333..22581 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
QDW64_RS23465 (QDW64_23460) 22578..22925 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
QDW64_RS23470 (QDW64_23465) 23286..23789 + 504 WP_089552162.1 relaxosome-coupling protein TaxA -
QDW64_RS23475 (QDW64_23470) 23793..25022 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
QDW64_RS23480 (QDW64_23475) 25099..25365 + 267 WP_000160396.1 hypothetical protein -
QDW64_RS23485 (QDW64_23480) 25370..25603 + 234 WP_000121161.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-2.1 - 1..34703 34703


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T277403 WP_001230707.1 NZ_CP122626:20369-20620 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT277403 WP_000801440.1 NZ_CP122626:20607-20834 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References