Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1840473..1841304 | Replicon | chromosome |
| Accession | NZ_CP122625 | ||
| Organism | Escherichia coli strain ETEC4089 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QDW64_RS08985 | Protein ID | WP_000854814.1 |
| Coordinates | 1840473..1840847 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | QDW64_RS08990 | Protein ID | WP_001285585.1 |
| Coordinates | 1840936..1841304 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW64_RS08945 (1835869) | 1835869..1837035 | + | 1167 | WP_000830163.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| QDW64_RS08950 (1837154) | 1837154..1837627 | + | 474 | WP_001105393.1 | DNA gyrase inhibitor SbmC | - |
| QDW64_RS08955 (1837825) | 1837825..1838883 | + | 1059 | WP_001200905.1 | FUSC family protein | - |
| QDW64_RS08960 (1839055) | 1839055..1839384 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QDW64_RS08965 (1839485) | 1839485..1839709 | - | 225 | WP_000917607.1 | EutP/PduV family microcompartment system protein | - |
| QDW64_RS08970 (1839721) | 1839721..1839867 | + | 147 | Protein_1753 | transposase domain-containing protein | - |
| QDW64_RS08975 (1840156) | 1840156..1840236 | - | 81 | Protein_1754 | hypothetical protein | - |
| QDW64_RS08980 (1840282) | 1840282..1840476 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QDW64_RS08985 (1840473) | 1840473..1840847 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDW64_RS08990 (1840936) | 1840936..1841304 | - | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QDW64_RS08995 (1841378) | 1841378..1841599 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QDW64_RS09000 (1841662) | 1841662..1842138 | - | 477 | WP_001186773.1 | RadC family protein | - |
| QDW64_RS09005 (1842154) | 1842154..1842633 | - | 480 | WP_000860076.1 | antirestriction protein | - |
| QDW64_RS09010 (1842715) | 1842715..1843536 | - | 822 | WP_001234530.1 | DUF932 domain-containing protein | - |
| QDW64_RS09015 (1843757) | 1843757..1844167 | - | 411 | WP_000846713.1 | hypothetical protein | - |
| QDW64_RS09020 (1844183) | 1844183..1844866 | - | 684 | WP_000775500.1 | hypothetical protein | - |
| QDW64_RS09025 (1845002) | 1845002..1846072 | - | 1071 | WP_000102643.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T277391 WP_000854814.1 NZ_CP122625:c1840847-1840473 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT277391 WP_001285585.1 NZ_CP122625:c1841304-1840936 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LW60 |