Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1840473..1841304 Replicon chromosome
Accession NZ_CP122625
Organism Escherichia coli strain ETEC4089

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QDW64_RS08985 Protein ID WP_000854814.1
Coordinates 1840473..1840847 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag QDW64_RS08990 Protein ID WP_001285585.1
Coordinates 1840936..1841304 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW64_RS08945 (1835869) 1835869..1837035 + 1167 WP_000830163.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QDW64_RS08950 (1837154) 1837154..1837627 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
QDW64_RS08955 (1837825) 1837825..1838883 + 1059 WP_001200905.1 FUSC family protein -
QDW64_RS08960 (1839055) 1839055..1839384 + 330 WP_000450409.1 DUF496 family protein -
QDW64_RS08965 (1839485) 1839485..1839709 - 225 WP_000917607.1 EutP/PduV family microcompartment system protein -
QDW64_RS08970 (1839721) 1839721..1839867 + 147 Protein_1753 transposase domain-containing protein -
QDW64_RS08975 (1840156) 1840156..1840236 - 81 Protein_1754 hypothetical protein -
QDW64_RS08980 (1840282) 1840282..1840476 - 195 WP_000988600.1 DUF5983 family protein -
QDW64_RS08985 (1840473) 1840473..1840847 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW64_RS08990 (1840936) 1840936..1841304 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QDW64_RS08995 (1841378) 1841378..1841599 - 222 WP_000692323.1 DUF987 domain-containing protein -
QDW64_RS09000 (1841662) 1841662..1842138 - 477 WP_001186773.1 RadC family protein -
QDW64_RS09005 (1842154) 1842154..1842633 - 480 WP_000860076.1 antirestriction protein -
QDW64_RS09010 (1842715) 1842715..1843536 - 822 WP_001234530.1 DUF932 domain-containing protein -
QDW64_RS09015 (1843757) 1843757..1844167 - 411 WP_000846713.1 hypothetical protein -
QDW64_RS09020 (1844183) 1844183..1844866 - 684 WP_000775500.1 hypothetical protein -
QDW64_RS09025 (1845002) 1845002..1846072 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T277391 WP_000854814.1 NZ_CP122625:c1840847-1840473 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT277391 WP_001285585.1 NZ_CP122625:c1841304-1840936 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References