Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 20373..20838 Replicon plasmid unnamed4
Accession NZ_CP122624
Organism Escherichia coli strain ETEC4090

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag QDW69_RS28385 Protein ID WP_001230707.1
Coordinates 20373..20624 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag QDW69_RS28390 Protein ID WP_000801440.1
Coordinates 20611..20838 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW69_RS28360 (QDW69_28360) 15852..16379 - 528 WP_000577043.1 DUF2726 domain-containing protein -
QDW69_RS28365 (QDW69_28365) 16516..16920 - 405 WP_012421203.1 hypothetical protein -
QDW69_RS28370 (QDW69_28370) 16933..17805 - 873 WP_001398251.1 replication initiation protein -
QDW69_RS28375 (QDW69_28375) 19214..19729 + 516 WP_001025395.1 J domain-containing protein -
QDW69_RS28380 (QDW69_28380) 19834..20376 + 543 WP_001083906.1 hypothetical protein -
QDW69_RS28385 (QDW69_28385) 20373..20624 + 252 WP_001230707.1 hypothetical protein Toxin
QDW69_RS28390 (QDW69_28390) 20611..20838 + 228 WP_000801440.1 hypothetical protein Antitoxin
QDW69_RS28395 (QDW69_28395) 21292..21591 + 300 WP_000650309.1 hypothetical protein -
QDW69_RS28400 (QDW69_28400) 21682..22032 + 351 WP_000854259.1 hypothetical protein -
QDW69_RS28405 (QDW69_28405) 22337..22585 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
QDW69_RS28410 (QDW69_28410) 22582..22929 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
QDW69_RS28415 (QDW69_28415) 23290..23793 + 504 WP_089552162.1 relaxosome-coupling protein TaxA -
QDW69_RS28420 (QDW69_28420) 23797..25026 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
QDW69_RS28425 (QDW69_28425) 25103..25369 + 267 WP_000160396.1 hypothetical protein -
QDW69_RS28430 (QDW69_28430) 25374..25607 + 234 WP_000121161.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-2.1 - 1..34707 34707


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T277383 WP_001230707.1 NZ_CP122624:20373-20624 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT277383 WP_000801440.1 NZ_CP122624:20611-20838 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References