Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 62052..62611 Replicon plasmid unnamed2
Accession NZ_CP122622
Organism Escherichia coli strain ETEC4090

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag QDW69_RS27310 Protein ID WP_000421257.1
Coordinates 62336..62611 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag QDW69_RS27305 Protein ID WP_001178089.1
Coordinates 62052..62336 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW69_RS27265 (57713) 57713..57904 + 192 WP_071849536.1 hypothetical protein -
QDW69_RS27270 (58148) 58148..58609 + 462 WP_069040904.1 thermonuclease family protein -
QDW69_RS27275 (58655) 58655..58864 + 210 WP_001333231.1 hemolysin expression modulator Hha -
QDW69_RS27280 (58902) 58902..59492 + 591 WP_012817838.1 DUF2726 domain-containing protein -
QDW69_RS27285 (59732) 59732..59992 + 261 WP_000083819.1 replication regulatory protein RepA -
QDW69_RS27290 (60018) 60018..60254 - 237 WP_244569896.1 replication protein RepA -
QDW69_RS27295 (60245) 60245..60292 + 48 WP_077822033.1 hypothetical protein -
QDW69_RS27300 (60285) 60285..61142 + 858 WP_282868250.1 incFII family plasmid replication initiator RepA -
QDW69_RS27305 (62052) 62052..62336 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
QDW69_RS27310 (62336) 62336..62611 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW69_RS27315 (62894) 62894..64081 - 1188 WP_000937591.1 IS91 family transposase -
QDW69_RS27320 (64081) 64081..64446 - 366 WP_000091308.1 hypothetical protein -
QDW69_RS27325 (64869) 64869..65342 - 474 WP_001122138.1 type II toxin-antitoxin system PemK/MazF family toxin -
QDW69_RS27330 (66133) 66133..66228 - 96 WP_000609147.1 DinQ-like type I toxin DqlB -
QDW69_RS27335 (66681) 66681..67103 - 423 WP_001398192.1 hypothetical protein -
QDW69_RS27340 (67275) 67275..67538 - 264 WP_000063165.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyB / hlyA / hlyC / estIa 1..120673 120673
- flank IS/Tn - - 62894..64081 1187


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T277376 WP_000421257.1 NZ_CP122622:62336-62611 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10456.86 Da        Isoelectric Point: 5.6558

>AT277376 WP_001178089.1 NZ_CP122622:62052-62336 [Escherichia coli]
IQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References