Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4850562..4851397 | Replicon | chromosome |
Accession | NZ_CP122620 | ||
Organism | Escherichia coli strain ETEC4090 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A3A6S2N5 |
Locus tag | QDW69_RS24685 | Protein ID | WP_000854800.1 |
Coordinates | 4851020..4851397 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A3Z2YIX3 |
Locus tag | QDW69_RS24680 | Protein ID | WP_032178229.1 |
Coordinates | 4850562..4850930 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW69_RS24655 (4847673) | 4847673..4848491 | + | 819 | WP_001234392.1 | DUF932 domain-containing protein | - |
QDW69_RS24660 (4848583) | 4848583..4849068 | + | 486 | WP_000213706.1 | antirestriction protein | - |
QDW69_RS24665 (4849083) | 4849083..4849559 | + | 477 | WP_001186784.1 | RadC family protein | - |
QDW69_RS24670 (4849628) | 4849628..4849849 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
QDW69_RS24675 (4849868) | 4849868..4850512 | + | 645 | WP_000086748.1 | hypothetical protein | - |
QDW69_RS24680 (4850562) | 4850562..4850930 | + | 369 | WP_032178229.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDW69_RS24685 (4851020) | 4851020..4851397 | + | 378 | WP_000854800.1 | TA system toxin CbtA family protein | Toxin |
QDW69_RS24690 (4851394) | 4851394..4851882 | + | 489 | WP_000779171.1 | DUF5983 family protein | - |
QDW69_RS24695 (4851894) | 4851894..4852091 | + | 198 | WP_001374283.1 | DUF957 domain-containing protein | - |
QDW69_RS24700 (4852176) | 4852176..4853018 | + | 843 | WP_063086391.1 | DUF4942 domain-containing protein | - |
QDW69_RS24705 (4853767) | 4853767..4855305 | + | 1539 | WP_001187173.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4823601..4863117 | 39516 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14068.13 Da Isoelectric Point: 9.1376
>T277370 WP_000854800.1 NZ_CP122620:4851020-4851397 [Escherichia coli]
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13823.58 Da Isoelectric Point: 6.3177
>AT277370 WP_032178229.1 NZ_CP122620:4850562-4850930 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6S2N5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z2YIX3 |