Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4002301..4002919 | Replicon | chromosome |
Accession | NZ_CP122620 | ||
Organism | Escherichia coli strain ETEC4090 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDW69_RS20390 | Protein ID | WP_001291435.1 |
Coordinates | 4002701..4002919 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDW69_RS20385 | Protein ID | WP_000344800.1 |
Coordinates | 4002301..4002675 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW69_RS20375 (3997390) | 3997390..3998583 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDW69_RS20380 (3998606) | 3998606..4001755 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QDW69_RS20385 (4002301) | 4002301..4002675 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDW69_RS20390 (4002701) | 4002701..4002919 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDW69_RS20395 (4003091) | 4003091..4003642 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDW69_RS20400 (4003758) | 4003758..4004228 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDW69_RS20405 (4004392) | 4004392..4005942 | + | 1551 | WP_001372457.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDW69_RS20410 (4005984) | 4005984..4006337 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDW69_RS20420 (4006716) | 4006716..4007027 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDW69_RS20425 (4007058) | 4007058..4007630 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277367 WP_001291435.1 NZ_CP122620:4002701-4002919 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277367 WP_000344800.1 NZ_CP122620:4002301-4002675 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |