Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3179764..3180598 Replicon chromosome
Accession NZ_CP122620
Organism Escherichia coli strain ETEC4090

Toxin (Protein)


Gene name yeeV Uniprot ID W0S379
Locus tag QDW69_RS16240 Protein ID WP_000854808.1
Coordinates 3179764..3180141 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QDW69_RS16245 Protein ID WP_236268536.1
Coordinates 3180230..3180598 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW69_RS16200 (3174980) 3174980..3175264 - 285 WP_236281258.1 hypothetical protein -
QDW69_RS16205 (3175359) 3175359..3175910 - 552 WP_032285112.1 hypothetical protein -
QDW69_RS16210 (3176275) 3176275..3176679 - 405 Protein_3172 zinc-binding phosphatase -
QDW69_RS16215 (3176734) 3176734..3177672 - 939 WP_000351317.1 glyoxylate/hydroxypyruvate reductase GhrA -
QDW69_RS16225 (3178143) 3178143..3178985 - 843 WP_001280436.1 DUF4942 domain-containing protein -
QDW69_RS16230 (3179070) 3179070..3179267 - 198 WP_000839248.1 DUF957 domain-containing protein -
QDW69_RS16235 (3179279) 3179279..3179767 - 489 WP_000761657.1 DUF5983 family protein -
QDW69_RS16240 (3179764) 3179764..3180141 - 378 WP_000854808.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW69_RS16245 (3180230) 3180230..3180598 - 369 WP_236268536.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW69_RS16250 (3180648) 3180648..3181292 - 645 WP_000086748.1 hypothetical protein -
QDW69_RS16255 (3181311) 3181311..3181532 - 222 WP_000692353.1 DUF987 domain-containing protein -
QDW69_RS16260 (3181601) 3181601..3182077 - 477 WP_001186784.1 RadC family protein -
QDW69_RS16265 (3182092) 3182092..3182577 - 486 WP_000213706.1 antirestriction protein -
QDW69_RS16270 (3182669) 3182669..3183487 - 819 WP_282867785.1 DUF932 domain-containing protein -
QDW69_RS16275 (3183580) 3183580..3183758 + 179 Protein_3184 hypothetical protein -
QDW69_RS16280 (3183898) 3183898..3184311 - 414 WP_000789535.1 hypothetical protein -
QDW69_RS16285 (3184581) 3184581..3185120 - 540 WP_001104020.1 DUF4339 domain-containing protein -
QDW69_RS16290 (3185245) 3185245..3185418 - 174 WP_001370911.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG 3135810..3182577 46767


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13909.93 Da        Isoelectric Point: 7.9085

>T277366 WP_000854808.1 NZ_CP122620:c3180141-3179764 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13781.63 Da        Isoelectric Point: 6.9460

>AT277366 WP_236268536.1 NZ_CP122620:c3180598-3180230 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W0S379

Antitoxin

Source ID Structure

References