Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3179764..3180598 | Replicon | chromosome |
| Accession | NZ_CP122620 | ||
| Organism | Escherichia coli strain ETEC4090 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | W0S379 |
| Locus tag | QDW69_RS16240 | Protein ID | WP_000854808.1 |
| Coordinates | 3179764..3180141 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QDW69_RS16245 | Protein ID | WP_236268536.1 |
| Coordinates | 3180230..3180598 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW69_RS16200 (3174980) | 3174980..3175264 | - | 285 | WP_236281258.1 | hypothetical protein | - |
| QDW69_RS16205 (3175359) | 3175359..3175910 | - | 552 | WP_032285112.1 | hypothetical protein | - |
| QDW69_RS16210 (3176275) | 3176275..3176679 | - | 405 | Protein_3172 | zinc-binding phosphatase | - |
| QDW69_RS16215 (3176734) | 3176734..3177672 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDW69_RS16225 (3178143) | 3178143..3178985 | - | 843 | WP_001280436.1 | DUF4942 domain-containing protein | - |
| QDW69_RS16230 (3179070) | 3179070..3179267 | - | 198 | WP_000839248.1 | DUF957 domain-containing protein | - |
| QDW69_RS16235 (3179279) | 3179279..3179767 | - | 489 | WP_000761657.1 | DUF5983 family protein | - |
| QDW69_RS16240 (3179764) | 3179764..3180141 | - | 378 | WP_000854808.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDW69_RS16245 (3180230) | 3180230..3180598 | - | 369 | WP_236268536.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW69_RS16250 (3180648) | 3180648..3181292 | - | 645 | WP_000086748.1 | hypothetical protein | - |
| QDW69_RS16255 (3181311) | 3181311..3181532 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| QDW69_RS16260 (3181601) | 3181601..3182077 | - | 477 | WP_001186784.1 | RadC family protein | - |
| QDW69_RS16265 (3182092) | 3182092..3182577 | - | 486 | WP_000213706.1 | antirestriction protein | - |
| QDW69_RS16270 (3182669) | 3182669..3183487 | - | 819 | WP_282867785.1 | DUF932 domain-containing protein | - |
| QDW69_RS16275 (3183580) | 3183580..3183758 | + | 179 | Protein_3184 | hypothetical protein | - |
| QDW69_RS16280 (3183898) | 3183898..3184311 | - | 414 | WP_000789535.1 | hypothetical protein | - |
| QDW69_RS16285 (3184581) | 3184581..3185120 | - | 540 | WP_001104020.1 | DUF4339 domain-containing protein | - |
| QDW69_RS16290 (3185245) | 3185245..3185418 | - | 174 | WP_001370911.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgB / csgD / csgE / csgF / csgG | 3135810..3182577 | 46767 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13909.93 Da Isoelectric Point: 7.9085
>T277366 WP_000854808.1 NZ_CP122620:c3180141-3179764 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13781.63 Da Isoelectric Point: 6.9460
>AT277366 WP_236268536.1 NZ_CP122620:c3180598-3180230 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|