Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 806620..807455 Replicon chromosome
Accession NZ_CP122620
Organism Escherichia coli strain ETEC4090

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QDW69_RS03965 Protein ID WP_000854821.1
Coordinates 806620..806997 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag QDW69_RS03970 Protein ID WP_001285610.1
Coordinates 807087..807455 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW69_RS03930 (801700) 801700..802299 + 600 WP_001255034.1 type II secretion system minor pseudopilin GspJ -
QDW69_RS03935 (802302) 802302..803279 + 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
QDW69_RS03940 (803276) 803276..804454 + 1179 WP_000094991.1 type II secretion system protein GspL -
QDW69_RS03945 (804456) 804456..804992 + 537 WP_000942785.1 GspM family type II secretion system protein YghD -
QDW69_RS03950 (805274) 805274..806116 - 843 WP_001280493.1 DUF4942 domain-containing protein -
QDW69_RS03955 (806201) 806201..806398 - 198 WP_085949090.1 DUF957 domain-containing protein -
QDW69_RS03960 (806426) 806426..806623 - 198 Protein_777 DUF5983 family protein -
QDW69_RS03965 (806620) 806620..806997 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW69_RS03970 (807087) 807087..807455 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW69_RS03975 (807535) 807535..807756 - 222 WP_000692350.1 DUF987 domain-containing protein -
QDW69_RS03980 (807843) 807843..808319 - 477 WP_001384108.1 RadC family protein -
QDW69_RS03985 (808335) 808335..808817 - 483 WP_000206657.1 antirestriction protein -
QDW69_RS03990 (808909) 808909..809727 - 819 WP_001175136.1 DUF932 domain-containing protein -
QDW69_RS03995 (809817) 809817..810050 - 234 WP_001117568.1 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T277349 WP_000854821.1 NZ_CP122620:c806997-806620 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT277349 WP_001285610.1 NZ_CP122620:c807455-807087 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References