Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 23983..24530 Replicon plasmid unnamed2
Accession NZ_CP122619
Organism Escherichia coli strain ETEC4091

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QDW52_RS23945 Protein ID WP_001384452.1
Coordinates 24252..24530 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag QDW52_RS23940 Protein ID WP_000079941.1
Coordinates 23983..24252 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW52_RS23925 (19283) 19283..19633 + 351 WP_000454193.1 DUF3330 domain-containing protein -
QDW52_RS23930 (19809) 19809..20369 + 561 WP_001161490.1 recombinase family protein -
QDW52_RS23935 (20373) 20373..23339 + 2967 WP_001138014.1 Tn3-like element TnAs1 family transposase -
QDW52_RS23940 (23983) 23983..24252 + 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDW52_RS23945 (24252) 24252..24530 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QDW52_RS23950 (24576) 24576..25424 + 849 WP_001057989.1 3'-5' exonuclease -
QDW52_RS23955 (25610) 25610..27490 + 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
QDW52_RS23960 (27512) 27512..27847 - 336 WP_001080729.1 colicin 1A immunity protein -
QDW52_RS23965 (27976) 27976..28191 + 216 Protein_34 DUF6404 family protein -
QDW52_RS23970 (28253) 28253..28843 - 591 WP_001518980.1 hypothetical protein -
QDW52_RS23975 (28840) 28840..29100 - 261 WP_000343091.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / dfrA5 / sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucD / iutA 1..149679 149679


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T277345 WP_001384452.1 NZ_CP122619:24252-24530 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT277345 WP_000079941.1 NZ_CP122619:23983-24252 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References