Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4283707..4284302 | Replicon | chromosome |
Accession | NZ_CP122617 | ||
Organism | Escherichia coli strain ETEC4091 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QDW52_RS20820 | Protein ID | WP_000239579.1 |
Coordinates | 4283707..4284057 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QDW52_RS20825 | Protein ID | WP_001223208.1 |
Coordinates | 4284051..4284302 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW52_RS20800 (4278983) | 4278983..4280005 | - | 1023 | WP_001339490.1 | ABC transporter permease | - |
QDW52_RS20805 (4280019) | 4280019..4281521 | - | 1503 | WP_021548597.1 | sugar ABC transporter ATP-binding protein | - |
QDW52_RS20810 (4281831) | 4281831..4282787 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QDW52_RS20815 (4283097) | 4283097..4283627 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
QDW52_RS20820 (4283707) | 4283707..4284057 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QDW52_RS20825 (4284051) | 4284051..4284302 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QDW52_RS20830 (4284515) | 4284515..4284856 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QDW52_RS20835 (4284859) | 4284859..4288638 | - | 3780 | WP_000060901.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T277341 WP_000239579.1 NZ_CP122617:c4284057-4283707 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |