Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3566073..3566910 | Replicon | chromosome |
Accession | NZ_CP122617 | ||
Organism | Escherichia coli strain ETEC4091 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QDW52_RS17480 | Protein ID | WP_000227784.1 |
Coordinates | 3566368..3566910 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QDW52_RS17475 | Protein ID | WP_001297137.1 |
Coordinates | 3566073..3566384 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW52_RS17450 (3561093) | 3561093..3562040 | + | 948 | WP_021548571.1 | cytochrome o ubiquinol oxidase subunit II | - |
QDW52_RS17455 (3562062) | 3562062..3564053 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QDW52_RS17460 (3564043) | 3564043..3564657 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QDW52_RS17465 (3564657) | 3564657..3564986 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QDW52_RS17470 (3564998) | 3564998..3565888 | + | 891 | WP_000971336.1 | heme o synthase | - |
QDW52_RS17475 (3566073) | 3566073..3566384 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QDW52_RS17480 (3566368) | 3566368..3566910 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QDW52_RS17485 (3566966) | 3566966..3567901 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QDW52_RS17490 (3568309) | 3568309..3569673 | + | 1365 | WP_001000978.1 | MFS transporter | - |
QDW52_RS17495 (3569801) | 3569801..3570292 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QDW52_RS17500 (3570460) | 3570460..3571371 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T277338 WP_000227784.1 NZ_CP122617:3566368-3566910 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|