Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3531996..3532614 | Replicon | chromosome |
| Accession | NZ_CP122617 | ||
| Organism | Escherichia coli strain ETEC4091 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDW52_RS17310 | Protein ID | WP_001291435.1 |
| Coordinates | 3532396..3532614 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDW52_RS17305 | Protein ID | WP_000344800.1 |
| Coordinates | 3531996..3532370 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW52_RS17295 (3527085) | 3527085..3528278 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDW52_RS17300 (3528301) | 3528301..3531450 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| QDW52_RS17305 (3531996) | 3531996..3532370 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDW52_RS17310 (3532396) | 3532396..3532614 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDW52_RS17315 (3532786) | 3532786..3533337 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| QDW52_RS17320 (3533453) | 3533453..3533923 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QDW52_RS17325 (3534087) | 3534087..3535637 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDW52_RS17330 (3535679) | 3535679..3536032 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDW52_RS17340 (3536411) | 3536411..3536722 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QDW52_RS17345 (3536753) | 3536753..3537325 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277337 WP_001291435.1 NZ_CP122617:3532396-3532614 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277337 WP_000344800.1 NZ_CP122617:3531996-3532370 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |