Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2433244..2433882 | Replicon | chromosome |
Accession | NZ_CP122617 | ||
Organism | Escherichia coli strain ETEC4091 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDW52_RS11735 | Protein ID | WP_000813794.1 |
Coordinates | 2433706..2433882 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDW52_RS11730 | Protein ID | WP_001270286.1 |
Coordinates | 2433244..2433660 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW52_RS11705 (2428561) | 2428561..2429214 | - | 654 | Protein_2288 | ABC transporter ATP-binding protein | - |
QDW52_RS11715 (2429983) | 2429983..2430351 | - | 369 | Protein_2290 | ABC transporter ATP-binding protein | - |
QDW52_RS11720 (2430369) | 2430369..2431514 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
QDW52_RS11725 (2431759) | 2431759..2433165 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
QDW52_RS11730 (2433244) | 2433244..2433660 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDW52_RS11735 (2433706) | 2433706..2433882 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDW52_RS11740 (2434104) | 2434104..2434334 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDW52_RS11745 (2434426) | 2434426..2436387 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDW52_RS11750 (2436460) | 2436460..2436996 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
QDW52_RS11755 (2437088) | 2437088..2438263 | + | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277335 WP_000813794.1 NZ_CP122617:c2433882-2433706 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277335 WP_001270286.1 NZ_CP122617:c2433660-2433244 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|