Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1818227..1819058 Replicon chromosome
Accession NZ_CP122617
Organism Escherichia coli strain ETEC4091

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QDW52_RS08765 Protein ID WP_000854814.1
Coordinates 1818227..1818601 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag QDW52_RS08770 Protein ID WP_001285585.1
Coordinates 1818690..1819058 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW52_RS08725 (1813623) 1813623..1814789 + 1167 WP_000830156.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QDW52_RS08730 (1814908) 1814908..1815381 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
QDW52_RS08735 (1815579) 1815579..1816637 + 1059 WP_029364112.1 FUSC family protein -
QDW52_RS08740 (1816809) 1816809..1817138 + 330 WP_000450409.1 DUF496 family protein -
QDW52_RS08745 (1817239) 1817239..1817373 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QDW52_RS08750 (1817493) 1817493..1817621 + 129 Protein_1708 transposase domain-containing protein -
QDW52_RS08755 (1817910) 1817910..1817990 - 81 Protein_1709 hypothetical protein -
QDW52_RS08760 (1818036) 1818036..1818230 - 195 WP_000988600.1 DUF5983 family protein -
QDW52_RS08765 (1818227) 1818227..1818601 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW52_RS08770 (1818690) 1818690..1819058 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QDW52_RS08775 (1819132) 1819132..1819353 - 222 WP_000692323.1 DUF987 domain-containing protein -
QDW52_RS08780 (1819416) 1819416..1819892 - 477 WP_001186773.1 RadC family protein -
QDW52_RS08785 (1819908) 1819908..1820387 - 480 WP_000860076.1 antirestriction protein -
QDW52_RS08790 (1820469) 1820469..1821290 - 822 WP_001234530.1 DUF932 domain-containing protein -
QDW52_RS08795 (1821511) 1821511..1821921 - 411 WP_000846713.1 hypothetical protein -
QDW52_RS08800 (1821937) 1821937..1822620 - 684 WP_023147547.1 hypothetical protein -
QDW52_RS08805 (1822756) 1822756..1823097 - 342 Protein_1719 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T277329 WP_000854814.1 NZ_CP122617:c1818601-1818227 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT277329 WP_001285585.1 NZ_CP122617:c1819058-1818690 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References