Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1285514..1286139 | Replicon | chromosome |
Accession | NZ_CP122617 | ||
Organism | Escherichia coli strain ETEC4091 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDW52_RS06245 | Protein ID | WP_000911330.1 |
Coordinates | 1285741..1286139 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QDW52_RS06240 | Protein ID | WP_000450524.1 |
Coordinates | 1285514..1285741 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW52_RS06215 (1281317) | 1281317..1281787 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QDW52_RS06220 (1281787) | 1281787..1282359 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QDW52_RS06225 (1282505) | 1282505..1283383 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QDW52_RS06230 (1283400) | 1283400..1284434 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QDW52_RS06235 (1284647) | 1284647..1285360 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QDW52_RS06240 (1285514) | 1285514..1285741 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QDW52_RS06245 (1285741) | 1285741..1286139 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDW52_RS06250 (1286286) | 1286286..1287149 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QDW52_RS06255 (1287164) | 1287164..1289179 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QDW52_RS06260 (1289253) | 1289253..1289951 | + | 699 | WP_000679823.1 | esterase | - |
QDW52_RS06265 (1290061) | 1290061..1290261 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T277327 WP_000911330.1 NZ_CP122617:1285741-1286139 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|