Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 994496..995079 | Replicon | chromosome |
Accession | NZ_CP122617 | ||
Organism | Escherichia coli strain ETEC4091 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QDW52_RS04820 | Protein ID | WP_021548855.1 |
Coordinates | 994744..995079 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QDW52_RS04815 | Protein ID | WP_000581937.1 |
Coordinates | 994496..994744 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW52_RS04805 (990835) | 990835..992136 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QDW52_RS04810 (992184) | 992184..994418 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QDW52_RS04815 (994496) | 994496..994744 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QDW52_RS04820 (994744) | 994744..995079 | + | 336 | WP_021548855.1 | endoribonuclease MazF | Toxin |
QDW52_RS04825 (995150) | 995150..995941 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QDW52_RS04830 (996169) | 996169..997806 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QDW52_RS04835 (997894) | 997894..999192 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
QDW52_RS04840 (999248) | 999248..999610 | - | 363 | WP_000034929.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12186.13 Da Isoelectric Point: 8.4777
>T277326 WP_021548855.1 NZ_CP122617:994744-995079 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPVVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPVVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|