Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 286275..287075 | Replicon | chromosome |
Accession | NZ_CP122617 | ||
Organism | Escherichia coli strain ETEC4091 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4NNI0 |
Locus tag | QDW52_RS01305 | Protein ID | WP_000342449.1 |
Coordinates | 286548..287075 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | QDW52_RS01300 | Protein ID | WP_001277108.1 |
Coordinates | 286275..286541 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW52_RS01280 (281933) | 281933..282601 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
QDW52_RS01285 (282594) | 282594..283652 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
QDW52_RS01290 (283897) | 283897..284751 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
QDW52_RS01295 (285022) | 285022..286125 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
QDW52_RS01300 (286275) | 286275..286541 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
QDW52_RS01305 (286548) | 286548..287075 | + | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
QDW52_RS01310 (287072) | 287072..287455 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
QDW52_RS01315 (287879) | 287879..288988 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QDW52_RS01320 (289036) | 289036..289962 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QDW52_RS01325 (289959) | 289959..291236 | + | 1278 | WP_000803771.1 | branched chain amino acid ABC transporter permease LivM | - |
QDW52_RS01330 (291233) | 291233..292000 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T277323 WP_000342449.1 NZ_CP122617:286548-287075 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CN24 |