Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 21916..22417 Replicon plasmid unnamed4
Accession NZ_CP122608
Organism Escherichia coli strain ETEC6334

Toxin (Protein)


Gene name TsxA Uniprot ID H1ZXU8
Locus tag QDW51_RS26600 Protein ID WP_000702247.1
Coordinates 22157..22417 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QDW51_RS26595 Protein ID WP_001132407.1
Coordinates 21916..22167 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW51_RS26555 (QDW51_26555) 16973..17725 + 753 WP_000797966.1 conjugal transfer protein TraL -
QDW51_RS26560 (QDW51_26560) 17727..18434 + 708 WP_021503228.1 hypothetical protein -
QDW51_RS26565 (QDW51_26565) 18454..18780 + 327 WP_000206697.1 hypothetical protein -
QDW51_RS26570 (QDW51_26570) 18911..19348 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QDW51_RS26575 (QDW51_26575) 19373..19555 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
QDW51_RS26580 (QDW51_26580) 19852..20295 + 444 WP_000068545.1 hypothetical protein -
QDW51_RS26585 (QDW51_26585) 20402..20668 - 267 WP_000681608.1 type II toxin-antitoxin system HicB family antitoxin -
QDW51_RS26590 (QDW51_26590) 21088..21366 - 279 WP_000545938.1 hypothetical protein -
QDW51_RS26595 (QDW51_26595) 21916..22167 - 252 WP_001132407.1 transcriptional regulator Antitoxin
QDW51_RS26600 (QDW51_26600) 22157..22417 - 261 WP_000702247.1 hypothetical protein Toxin
QDW51_RS26605 (QDW51_26605) 22469..22693 - 225 WP_000814381.1 hypothetical protein -
QDW51_RS26610 (QDW51_26610) 22790..22999 - 210 WP_000866036.1 hypothetical protein -
QDW51_RS26615 (QDW51_26615) 23041..23364 - 324 WP_000427403.1 hypothetical protein -
QDW51_RS26620 (QDW51_26620) 23945..24274 - 330 WP_000855120.1 hypothetical protein -
QDW51_RS26625 (QDW51_26625) 24872..25537 + 666 WP_000532148.1 division plane positioning ATPase MipZ -
QDW51_RS26630 (QDW51_26630) 25611..25895 + 285 WP_001162371.1 hypothetical protein -
QDW51_RS26635 (QDW51_26635) 25913..26509 - 597 WP_000125165.1 ProQ/FINO family protein -
QDW51_RS26640 (QDW51_26640) 26659..26781 - 123 WP_223170659.1 type I toxin-antitoxin system Hok family toxin -
QDW51_RS26645 (QDW51_26645) 26726..26878 - 153 Protein_33 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..57782 57782


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9817.29 Da        Isoelectric Point: 10.0665

>T277321 WP_000702247.1 NZ_CP122608:c22417-22157 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT277321 WP_001132407.1 NZ_CP122608:c22167-21916 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1P8DNC0

Antitoxin

Source ID Structure

References