Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 13228..13775 Replicon plasmid unnamed3
Accession NZ_CP122607
Organism Escherichia coli strain ETEC6334

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QDW51_RS26430 Protein ID WP_244461648.1
Coordinates 13497..13775 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A2H4TKA5
Locus tag QDW51_RS26425 Protein ID WP_000079937.1
Coordinates 13228..13497 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW51_RS26395 (QDW51_26395) 8769..9359 + 591 WP_001375082.1 DUF2726 domain-containing protein -
QDW51_RS26400 (QDW51_26400) 9599..9847 + 249 WP_000083839.1 replication regulatory protein RepA -
QDW51_RS26405 (QDW51_26405) 10092..10166 + 75 WP_001365705.1 RepA leader peptide Tap -
QDW51_RS26410 (QDW51_26410) 10159..11016 + 858 WP_042634321.1 incFII family plasmid replication initiator RepA -
QDW51_RS26415 (QDW51_26415) 11718..11858 + 141 WP_001384252.1 hypothetical protein -
QDW51_RS26420 (QDW51_26420) 12015..13052 + 1038 WP_032083970.1 DNA-binding protein -
QDW51_RS26425 (QDW51_26425) 13228..13497 + 270 WP_000079937.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDW51_RS26430 (QDW51_26430) 13497..13775 + 279 WP_244461648.1 type II toxin-antitoxin system toxin YacB Toxin
QDW51_RS26435 (QDW51_26435) 14039..14539 + 501 WP_282833034.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
QDW51_RS26440 (QDW51_26440) 14712..15899 - 1188 WP_000937591.1 IS91 family transposase -
QDW51_RS26445 (QDW51_26445) 15899..16264 - 366 WP_282833035.1 hypothetical protein -
QDW51_RS26450 (QDW51_26450) 16489..16883 - 395 Protein_23 plasmid partitioning/stability family protein -
QDW51_RS26455 (QDW51_26455) 16883..17842 - 960 WP_000921958.1 plasmid segregation protein ParM -
QDW51_RS26460 (QDW51_26460) 18257..18382 + 126 Protein_25 hypothetical protein -
QDW51_RS26465 (QDW51_26465) 18377..18562 + 186 Protein_26 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..19834 19834
- flank IS/Tn - - 14712..15899 1187


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10732.29 Da        Isoelectric Point: 8.4615

>T277320 WP_244461648.1 NZ_CP122607:13497-13775 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLTAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10174.56 Da        Isoelectric Point: 10.1760

>AT277320 WP_000079937.1 NZ_CP122607:13228-13497 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLKHGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2H4TKA5

References