Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PanAT/DUF4065(antitoxin)
Location 4733435..4734360 Replicon chromosome
Accession NZ_CP122604
Organism Escherichia coli strain ETEC6334

Toxin (Protein)


Gene name panT Uniprot ID -
Locus tag QDW51_RS23425 Protein ID WP_014640052.1
Coordinates 4733435..4733821 (-) Length 129 a.a.

Antitoxin (Protein)


Gene name panA Uniprot ID -
Locus tag QDW51_RS23430 Protein ID WP_024174200.1
Coordinates 4733851..4734360 (-) Length 170 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW51_RS23365 (4728539) 4728539..4729363 + 825 WP_097420368.1 DUF2303 family protein -
QDW51_RS23370 (4729492) 4729492..4730028 + 537 WP_175286063.1 5'-deoxynucleotidase -
QDW51_RS23375 (4730019) 4730019..4730381 + 363 WP_001242718.1 phage protein -
QDW51_RS23380 (4730378) 4730378..4730581 + 204 WP_000111289.1 hypothetical protein -
QDW51_RS23385 (4730574) 4730574..4730813 + 240 WP_112023949.1 hypothetical protein -
QDW51_RS23390 (4730810) 4730810..4731337 + 528 WP_075843227.1 ead/Ea22-like family protein -
QDW51_RS23395 (4731339) 4731339..4731530 + 192 WP_001014290.1 hypothetical protein -
QDW51_RS23400 (4731533) 4731533..4731847 + 315 Protein_4584 DUF551 domain-containing protein -
QDW51_RS23405 (4732094) 4732094..4732285 + 192 WP_001690200.1 DUF551 domain-containing protein -
QDW51_RS23410 (4732285) 4732285..4732857 + 573 WP_001061345.1 3'-5' exonuclease -
QDW51_RS23415 (4732894) 4732894..4733175 + 282 WP_001093917.1 pyocin activator PrtN family protein -
QDW51_RS23420 (4733222) 4733222..4733395 - 174 WP_000390072.1 hypothetical protein -
QDW51_RS23425 (4733435) 4733435..4733821 - 387 WP_014640052.1 hypothetical protein Toxin
QDW51_RS23430 (4733851) 4733851..4734360 - 510 WP_024174200.1 Panacea domain-containing protein Antitoxin
QDW51_RS23435 (4734677) 4734677..4734781 - 105 Protein_4591 tRNA-dihydrouridine synthase -
QDW51_RS23440 (4735144) 4735144..4736100 - 957 WP_063085441.1 DUF2713 family protein -
QDW51_RS23445 (4736418) 4736418..4736933 + 516 WP_001295691.1 zinc uptake transcriptional repressor Zur -
QDW51_RS23450 (4736975) 4736975..4737184 - 210 WP_001030593.1 CsbD family protein -
QDW51_RS23455 (4737300) 4737300..4738625 - 1326 WP_001545103.1 MATE family efflux transporter DinF -
QDW51_RS23460 (4738698) 4738698..4739306 - 609 WP_000646078.1 transcriptional repressor LexA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4686678..4739306 52628


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Antitoxin SocA-like, Panacea domain

(6-116)


Sequences

Toxin        


Download         Length: 129 a.a.        Molecular weight: 14465.40 Da        Isoelectric Point: 5.4833

>T277318 WP_014640052.1 NZ_CP122604:c4733821-4733435 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE

Download         Length: 387 bp

Antitoxin


Download         Length: 170 a.a.        Molecular weight: 19559.39 Da        Isoelectric Point: 5.3338

>AT277318 WP_024174200.1 NZ_CP122604:c4734360-4733851 [Escherichia coli]
MAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYNLIETNGHDVLLRSDPREMDAD
EVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLISEGKSEDEANRIIGKMEESQK
LKEFSLQLS

Download         Length: 510 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References