Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3747312..3747930 | Replicon | chromosome |
| Accession | NZ_CP122604 | ||
| Organism | Escherichia coli strain ETEC6334 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDW51_RS18445 | Protein ID | WP_001291435.1 |
| Coordinates | 3747712..3747930 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDW51_RS18440 | Protein ID | WP_000344800.1 |
| Coordinates | 3747312..3747686 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW51_RS18430 (3742401) | 3742401..3743594 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDW51_RS18435 (3743617) | 3743617..3746766 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QDW51_RS18440 (3747312) | 3747312..3747686 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDW51_RS18445 (3747712) | 3747712..3747930 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDW51_RS18450 (3748102) | 3748102..3748653 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| QDW51_RS18455 (3748769) | 3748769..3749239 | + | 471 | WP_063085325.1 | YlaC family protein | - |
| QDW51_RS18460 (3749403) | 3749403..3750953 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDW51_RS18465 (3750995) | 3750995..3751348 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDW51_RS18475 (3751727) | 3751727..3752038 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QDW51_RS18480 (3752069) | 3752069..3752641 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277312 WP_001291435.1 NZ_CP122604:3747712-3747930 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277312 WP_000344800.1 NZ_CP122604:3747312-3747686 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |