Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3314689..3315394 | Replicon | chromosome |
Accession | NZ_CP122604 | ||
Organism | Escherichia coli strain ETEC6334 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3A6SJV3 |
Locus tag | QDW51_RS16425 | Protein ID | WP_063085620.1 |
Coordinates | 3314689..3315075 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QDW51_RS16430 | Protein ID | WP_219804798.1 |
Coordinates | 3315065..3315394 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW51_RS16405 (3310693) | 3310693..3311319 | + | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
QDW51_RS16410 (3311316) | 3311316..3312431 | - | 1116 | WP_063085618.1 | aldose sugar dehydrogenase YliI | - |
QDW51_RS16415 (3312542) | 3312542..3312925 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
QDW51_RS16420 (3313138) | 3313138..3314463 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
QDW51_RS16425 (3314689) | 3314689..3315075 | + | 387 | WP_063085620.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDW51_RS16430 (3315065) | 3315065..3315394 | + | 330 | WP_219804798.1 | DNA-binding transcriptional regulator | Antitoxin |
QDW51_RS16435 (3315464) | 3315464..3316792 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
QDW51_RS16440 (3316800) | 3316800..3319148 | - | 2349 | WP_021523051.1 | EAL domain-containing protein | - |
QDW51_RS16445 (3319326) | 3319326..3320237 | - | 912 | WP_001236019.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14280.45 Da Isoelectric Point: 9.9296
>T277311 WP_063085620.1 NZ_CP122604:3314689-3315075 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|