Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2602622..2603260 | Replicon | chromosome |
| Accession | NZ_CP122604 | ||
| Organism | Escherichia coli strain ETEC6334 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
| Locus tag | QDW51_RS12760 | Protein ID | WP_063085535.1 |
| Coordinates | 2603084..2603260 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDW51_RS12755 | Protein ID | WP_001270286.1 |
| Coordinates | 2602622..2603038 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW51_RS12735 (2597774) | 2597774..2598715 | - | 942 | WP_063085538.1 | ABC transporter permease | - |
| QDW51_RS12740 (2598716) | 2598716..2599729 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
| QDW51_RS12745 (2599747) | 2599747..2600892 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
| QDW51_RS12750 (2601137) | 2601137..2602543 | - | 1407 | WP_282832768.1 | PLP-dependent aminotransferase family protein | - |
| QDW51_RS12755 (2602622) | 2602622..2603038 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDW51_RS12760 (2603084) | 2603084..2603260 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDW51_RS12765 (2603482) | 2603482..2603712 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QDW51_RS12770 (2603804) | 2603804..2605765 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDW51_RS12775 (2605838) | 2605838..2606374 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
| QDW51_RS12780 (2606466) | 2606466..2607637 | + | 1172 | Protein_2503 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277306 WP_063085535.1 NZ_CP122604:c2603260-2603084 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277306 WP_001270286.1 NZ_CP122604:c2603038-2602622 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|