Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PanAT/DUF4065(antitoxin)
Location 4733428..4734353 Replicon chromosome
Accession NZ_CP122600
Organism Escherichia coli strain ETEC6333

Toxin (Protein)


Gene name panT Uniprot ID -
Locus tag QDX83_RS23430 Protein ID WP_014640052.1
Coordinates 4733428..4733814 (-) Length 129 a.a.

Antitoxin (Protein)


Gene name panA Uniprot ID -
Locus tag QDX83_RS23435 Protein ID WP_024174200.1
Coordinates 4733844..4734353 (-) Length 170 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX83_RS23370 (4728532) 4728532..4729356 + 825 WP_097420368.1 DUF2303 family protein -
QDX83_RS23375 (4729485) 4729485..4730021 + 537 WP_175286063.1 5'-deoxynucleotidase -
QDX83_RS23380 (4730012) 4730012..4730374 + 363 WP_001242718.1 phage protein -
QDX83_RS23385 (4730371) 4730371..4730574 + 204 WP_000111289.1 hypothetical protein -
QDX83_RS23390 (4730567) 4730567..4730806 + 240 WP_112023949.1 hypothetical protein -
QDX83_RS23395 (4730803) 4730803..4731330 + 528 WP_075843227.1 ead/Ea22-like family protein -
QDX83_RS23400 (4731332) 4731332..4731523 + 192 WP_001014290.1 hypothetical protein -
QDX83_RS23405 (4731526) 4731526..4731840 + 315 Protein_4585 DUF551 domain-containing protein -
QDX83_RS23410 (4732087) 4732087..4732278 + 192 WP_001690200.1 DUF551 domain-containing protein -
QDX83_RS23415 (4732278) 4732278..4732850 + 573 WP_001061345.1 3'-5' exonuclease -
QDX83_RS23420 (4732887) 4732887..4733168 + 282 WP_001093917.1 pyocin activator PrtN family protein -
QDX83_RS23425 (4733215) 4733215..4733388 - 174 WP_000390072.1 hypothetical protein -
QDX83_RS23430 (4733428) 4733428..4733814 - 387 WP_014640052.1 hypothetical protein Toxin
QDX83_RS23435 (4733844) 4733844..4734353 - 510 WP_024174200.1 Panacea domain-containing protein Antitoxin
QDX83_RS23440 (4734670) 4734670..4734774 - 105 Protein_4592 tRNA-dihydrouridine synthase -
QDX83_RS23445 (4735137) 4735137..4736093 - 957 WP_063085441.1 DUF2713 family protein -
QDX83_RS23450 (4736411) 4736411..4736926 + 516 WP_001295691.1 zinc uptake transcriptional repressor Zur -
QDX83_RS23455 (4736968) 4736968..4737177 - 210 WP_001030593.1 CsbD family protein -
QDX83_RS23460 (4737293) 4737293..4738618 - 1326 WP_001545103.1 MATE family efflux transporter DinF -
QDX83_RS23465 (4738691) 4738691..4739299 - 609 WP_000646078.1 transcriptional repressor LexA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4686662..4739299 52637
- inside Prophage - - 4686662..4739777 53115


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Antitoxin SocA-like, Panacea domain

(6-116)


Sequences

Toxin        


Download         Length: 129 a.a.        Molecular weight: 14465.40 Da        Isoelectric Point: 5.4833

>T277293 WP_014640052.1 NZ_CP122600:c4733814-4733428 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE

Download         Length: 387 bp

Antitoxin


Download         Length: 170 a.a.        Molecular weight: 19559.39 Da        Isoelectric Point: 5.3338

>AT277293 WP_024174200.1 NZ_CP122600:c4734353-4733844 [Escherichia coli]
MAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYNLIETNGHDVLLRSDPREMDAD
EVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLISEGKSEDEANRIIGKMEESQK
LKEFSLQLS

Download         Length: 510 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References