Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3747295..3747913 | Replicon | chromosome |
Accession | NZ_CP122600 | ||
Organism | Escherichia coli strain ETEC6333 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDX83_RS18450 | Protein ID | WP_001291435.1 |
Coordinates | 3747695..3747913 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDX83_RS18445 | Protein ID | WP_000344800.1 |
Coordinates | 3747295..3747669 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX83_RS18435 (3742384) | 3742384..3743577 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDX83_RS18440 (3743600) | 3743600..3746749 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
QDX83_RS18445 (3747295) | 3747295..3747669 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDX83_RS18450 (3747695) | 3747695..3747913 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDX83_RS18455 (3748085) | 3748085..3748636 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDX83_RS18460 (3748752) | 3748752..3749222 | + | 471 | WP_063085325.1 | YlaC family protein | - |
QDX83_RS18465 (3749386) | 3749386..3750936 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDX83_RS18470 (3750978) | 3750978..3751331 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDX83_RS18480 (3751710) | 3751710..3752021 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDX83_RS18485 (3752052) | 3752052..3752624 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277287 WP_001291435.1 NZ_CP122600:3747695-3747913 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277287 WP_000344800.1 NZ_CP122600:3747295-3747669 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |