Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2602600..2603238 | Replicon | chromosome |
| Accession | NZ_CP122600 | ||
| Organism | Escherichia coli strain ETEC6333 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
| Locus tag | QDX83_RS12760 | Protein ID | WP_063085535.1 |
| Coordinates | 2603062..2603238 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDX83_RS12755 | Protein ID | WP_001270286.1 |
| Coordinates | 2602600..2603016 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX83_RS12735 (2597752) | 2597752..2598693 | - | 942 | WP_063085538.1 | ABC transporter permease | - |
| QDX83_RS12740 (2598694) | 2598694..2599707 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
| QDX83_RS12745 (2599725) | 2599725..2600870 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
| QDX83_RS12750 (2601115) | 2601115..2602521 | - | 1407 | WP_282832768.1 | PLP-dependent aminotransferase family protein | - |
| QDX83_RS12755 (2602600) | 2602600..2603016 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDX83_RS12760 (2603062) | 2603062..2603238 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDX83_RS12765 (2603460) | 2603460..2603690 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QDX83_RS12770 (2603782) | 2603782..2605743 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDX83_RS12775 (2605816) | 2605816..2606352 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
| QDX83_RS12780 (2606444) | 2606444..2607615 | + | 1172 | Protein_2503 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277281 WP_063085535.1 NZ_CP122600:c2603238-2603062 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277281 WP_001270286.1 NZ_CP122600:c2603016-2602600 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|