Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 18509..19110 | Replicon | plasmid unnamed9 |
Accession | NZ_CP122597 | ||
Organism | Escherichia coli strain ETEC6335 |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9YA20 |
Locus tag | QDY30_RS27830 | Protein ID | WP_001216045.1 |
Coordinates | 18509..18889 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QDY30_RS27835 | Protein ID | WP_001190712.1 |
Coordinates | 18889..19110 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY30_RS27805 (QDY30_27815) | 13950..15434 | - | 1485 | WP_000124150.1 | terminase | - |
QDY30_RS27810 (QDY30_27820) | 15434..16627 | - | 1194 | WP_096321055.1 | terminase | - |
QDY30_RS27815 (QDY30_27825) | 16713..17165 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
QDY30_RS27820 (QDY30_27830) | 17254..18297 | - | 1044 | WP_069187067.1 | DUF968 domain-containing protein | - |
QDY30_RS27825 (QDY30_27835) | 18325..18504 | - | 180 | WP_001339207.1 | hypothetical protein | - |
QDY30_RS27830 (QDY30_27840) | 18509..18889 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QDY30_RS27835 (QDY30_27845) | 18889..19110 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QDY30_RS27840 (QDY30_27850) | 19293..20849 | + | 1557 | WP_096314329.1 | type I restriction-modification system subunit M | - |
QDY30_RS27845 (QDY30_27855) | 20846..22054 | + | 1209 | WP_106108225.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..92714 | 92714 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T277270 WP_001216045.1 NZ_CP122597:c18889-18509 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLP7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |