Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 25312..25813 Replicon plasmid unnamed7
Accession NZ_CP122595
Organism Escherichia coli strain ETEC6335

Toxin (Protein)


Gene name TsxA Uniprot ID A0A6X6XTU7
Locus tag QDY30_RS27280 Protein ID WP_000702245.1
Coordinates 25553..25813 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QDY30_RS27275 Protein ID WP_001132407.1
Coordinates 25312..25563 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY30_RS27235 (QDY30_27245) 20514..20840 + 327 WP_000206701.1 hypothetical protein -
QDY30_RS27240 (QDY30_27250) 20971..21408 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QDY30_RS27245 (QDY30_27255) 21433..21615 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
QDY30_RS27250 (QDY30_27260) 21912..22355 + 444 WP_000068545.1 hypothetical protein -
QDY30_RS27255 (QDY30_27265) 22462..22728 - 267 WP_000681608.1 type II toxin-antitoxin system HicB family antitoxin -
QDY30_RS27260 (QDY30_27270) 22948..24156 - 1209 WP_059260046.1 RNA-guided endonuclease TnpB family protein -
QDY30_RS27265 (QDY30_27275) 24181..24288 + 108 Protein_26 hypothetical protein -
QDY30_RS27270 (QDY30_27280) 24484..24762 - 279 WP_000545937.1 hypothetical protein -
QDY30_RS27275 (QDY30_27285) 25312..25563 - 252 WP_001132407.1 transcriptional regulator Antitoxin
QDY30_RS27280 (QDY30_27290) 25553..25813 - 261 WP_000702245.1 hypothetical protein Toxin
QDY30_RS27285 (QDY30_27295) 25865..26089 - 225 WP_021538569.1 hypothetical protein -
QDY30_RS27290 (QDY30_27300) 26187..26396 - 210 WP_000866037.1 hypothetical protein -
QDY30_RS27295 (QDY30_27305) 26437..26760 - 324 WP_000427402.1 hypothetical protein -
QDY30_RS27300 (QDY30_27310) 27341..27670 - 330 WP_000855121.1 hypothetical protein -
QDY30_RS27305 (QDY30_27315) 28267..28932 + 666 WP_000532148.1 division plane positioning ATPase MipZ -
QDY30_RS27310 (QDY30_27320) 29006..29290 + 285 WP_001162371.1 hypothetical protein -
QDY30_RS27315 (QDY30_27325) 29308..29904 - 597 WP_000125164.1 ProQ/FINO family protein -
QDY30_RS27320 (QDY30_27330) 30054..30176 - 123 WP_223202818.1 Hok/Gef family protein -
QDY30_RS27325 (QDY30_27335) 30121..30273 - 153 Protein_38 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..64291 64291
- flank IS/Tn - - 22948..24096 1148


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9818.23 Da        Isoelectric Point: 9.5163

>T277268 WP_000702245.1 NZ_CP122595:c25813-25553 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT277268 WP_001132407.1 NZ_CP122595:c25563-25312 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6X6XTU7

Antitoxin

Source ID Structure

References