Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 90723..91324 Replicon plasmid unnamed5
Accession NZ_CP122593
Organism Escherichia coli strain ETEC6335

Toxin (Protein)


Gene name doc Uniprot ID A0A731GHK2
Locus tag QDY30_RS27025 Protein ID WP_001216038.1
Coordinates 90944..91324 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QDY30_RS27020 Protein ID WP_001190712.1
Coordinates 90723..90944 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY30_RS26960 (QDY30_26960) 86147..86350 + 204 WP_000158003.1 hypothetical protein -
QDY30_RS26965 (QDY30_26965) 86343..86582 + 240 WP_000476201.1 hypothetical protein -
QDY30_RS26970 (QDY30_26970) 86579..87304 + 726 WP_000078034.1 ead/Ea22-like family protein -
QDY30_RS26975 (QDY30_26975) 87306..87500 + 195 WP_000224731.1 hypothetical protein -
QDY30_RS26980 (QDY30_26980) 87502..87711 + 210 WP_000951712.1 hypothetical protein -
QDY30_RS26985 (QDY30_26985) 87708..87842 + 135 Protein_103 hypothetical protein -
QDY30_RS26990 (QDY30_26990) 88023..88874 + 852 WP_227456489.1 hypothetical protein -
QDY30_RS26995 (QDY30_26995) 88858..89142 + 285 WP_001142397.1 hypothetical protein -
QDY30_RS27000 (QDY30_27000) 89127..89477 - 351 WP_227456484.1 hypothetical protein -
QDY30_RS27005 (QDY30_27005) 89510..89608 + 99 Protein_107 DNA polymerase III subunit theta -
QDY30_RS27010 (QDY30_27010) 89668..90057 + 390 WP_000506729.1 S24 family peptidase -
QDY30_RS27015 (QDY30_27015) 90192..90614 + 423 WP_000098854.1 hypothetical protein -
QDY30_RS27020 (QDY30_27020) 90723..90944 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDY30_RS27025 (QDY30_27025) 90944..91324 + 381 WP_001216038.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDY30_RS27030 (QDY30_27030) 91329..91526 + 198 WP_000113017.1 hypothetical protein -
QDY30_RS27035 (QDY30_27035) 91559..92335 - 777 WP_000432096.1 hypothetical protein -
QDY30_RS27040 (QDY30_27040) 92342..93019 - 678 WP_001061874.1 DUF2829 domain-containing protein -
QDY30_RS27045 (QDY30_27045) 93034..93528 - 495 WP_000640907.1 dUTP diphosphatase -
QDY30_RS27050 (QDY30_27050) 93525..94001 - 477 WP_000861175.1 hypothetical protein -
QDY30_RS27055 (QDY30_27055) 93998..94342 - 345 WP_001191776.1 hypothetical protein -
QDY30_RS27060 (QDY30_27060) 94416..95444 - 1029 WP_001292235.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..95838 95838


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T277267 WP_001216038.1 NZ_CP122593:90944-91324 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEISDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT277267 WP_001190712.1 NZ_CP122593:90723-90944 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A731GHK2

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References