Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 90723..91324 | Replicon | plasmid unnamed5 |
| Accession | NZ_CP122593 | ||
| Organism | Escherichia coli strain ETEC6335 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A731GHK2 |
| Locus tag | QDY30_RS27025 | Protein ID | WP_001216038.1 |
| Coordinates | 90944..91324 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QDY30_RS27020 | Protein ID | WP_001190712.1 |
| Coordinates | 90723..90944 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY30_RS26960 (QDY30_26960) | 86147..86350 | + | 204 | WP_000158003.1 | hypothetical protein | - |
| QDY30_RS26965 (QDY30_26965) | 86343..86582 | + | 240 | WP_000476201.1 | hypothetical protein | - |
| QDY30_RS26970 (QDY30_26970) | 86579..87304 | + | 726 | WP_000078034.1 | ead/Ea22-like family protein | - |
| QDY30_RS26975 (QDY30_26975) | 87306..87500 | + | 195 | WP_000224731.1 | hypothetical protein | - |
| QDY30_RS26980 (QDY30_26980) | 87502..87711 | + | 210 | WP_000951712.1 | hypothetical protein | - |
| QDY30_RS26985 (QDY30_26985) | 87708..87842 | + | 135 | Protein_103 | hypothetical protein | - |
| QDY30_RS26990 (QDY30_26990) | 88023..88874 | + | 852 | WP_227456489.1 | hypothetical protein | - |
| QDY30_RS26995 (QDY30_26995) | 88858..89142 | + | 285 | WP_001142397.1 | hypothetical protein | - |
| QDY30_RS27000 (QDY30_27000) | 89127..89477 | - | 351 | WP_227456484.1 | hypothetical protein | - |
| QDY30_RS27005 (QDY30_27005) | 89510..89608 | + | 99 | Protein_107 | DNA polymerase III subunit theta | - |
| QDY30_RS27010 (QDY30_27010) | 89668..90057 | + | 390 | WP_000506729.1 | S24 family peptidase | - |
| QDY30_RS27015 (QDY30_27015) | 90192..90614 | + | 423 | WP_000098854.1 | hypothetical protein | - |
| QDY30_RS27020 (QDY30_27020) | 90723..90944 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QDY30_RS27025 (QDY30_27025) | 90944..91324 | + | 381 | WP_001216038.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QDY30_RS27030 (QDY30_27030) | 91329..91526 | + | 198 | WP_000113017.1 | hypothetical protein | - |
| QDY30_RS27035 (QDY30_27035) | 91559..92335 | - | 777 | WP_000432096.1 | hypothetical protein | - |
| QDY30_RS27040 (QDY30_27040) | 92342..93019 | - | 678 | WP_001061874.1 | DUF2829 domain-containing protein | - |
| QDY30_RS27045 (QDY30_27045) | 93034..93528 | - | 495 | WP_000640907.1 | dUTP diphosphatase | - |
| QDY30_RS27050 (QDY30_27050) | 93525..94001 | - | 477 | WP_000861175.1 | hypothetical protein | - |
| QDY30_RS27055 (QDY30_27055) | 93998..94342 | - | 345 | WP_001191776.1 | hypothetical protein | - |
| QDY30_RS27060 (QDY30_27060) | 94416..95444 | - | 1029 | WP_001292235.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..95838 | 95838 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13574.27 Da Isoelectric Point: 5.1514
>T277267 WP_001216038.1 NZ_CP122593:90944-91324 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEISDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEISDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A731GHK2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |