Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 106776..107298 Replicon plasmid unnamed4
Accession NZ_CP122592
Organism Escherichia coli strain ETEC6335

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QDY30_RS26345 Protein ID WP_000220560.1
Coordinates 107017..107298 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QDY30_RS26340 Protein ID WP_000121743.1
Coordinates 106776..107027 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY30_RS26315 (102447) 102447..102728 + 282 WP_001185482.1 hypothetical protein -
QDY30_RS26320 (102753) 102753..103730 + 978 WP_001269910.1 hypothetical protein -
QDY30_RS26325 (103727) 103727..104083 - 357 WP_000456533.1 DNA distortion polypeptide 3 -
QDY30_RS26330 (104220) 104220..104666 - 447 WP_000057426.1 hypothetical protein -
QDY30_RS26335 (104706) 104706..105542 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
QDY30_RS26340 (106776) 106776..107027 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QDY30_RS26345 (107017) 107017..107298 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDY30_RS26350 (107444) 107444..107767 + 324 WP_001181907.1 hypothetical protein -
QDY30_RS26355 (107812) 107812..108057 + 246 WP_000356545.1 hypothetical protein -
QDY30_RS26360 (108047) 108047..108262 + 216 WP_001180116.1 hypothetical protein -
QDY30_RS26365 (108651) 108651..109838 - 1188 WP_000937591.1 IS91 family transposase -
QDY30_RS26370 (109838) 109838..110203 - 366 WP_000091308.1 hypothetical protein -
QDY30_RS26375 (110480) 110480..111667 - 1188 WP_116794643.1 IS91-like element IS91 family transposase -
QDY30_RS26380 (111630) 111630..112031 - 402 WP_000124097.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyC / hlyA / hlyB / hlyB / hlyD / estIa 1..120805 120805


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T277265 WP_000220560.1 NZ_CP122592:107017-107298 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT277265 WP_000121743.1 NZ_CP122592:106776-107027 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References