Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 109818..110461 | Replicon | plasmid unnamed1 |
Accession | NZ_CP122589 | ||
Organism | Escherichia coli strain ETEC6335 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | QDY30_RS25465 | Protein ID | WP_001044768.1 |
Coordinates | 109818..110234 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | QDY30_RS25470 | Protein ID | WP_001261287.1 |
Coordinates | 110231..110461 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY30_RS25450 (106317) | 106317..106907 | - | 591 | WP_000194575.1 | hypothetical protein | - |
QDY30_RS25455 (106907) | 106907..107164 | - | 258 | WP_000343085.1 | hypothetical protein | - |
QDY30_RS25460 (107518) | 107518..109656 | + | 2139 | WP_000350639.1 | AAA family ATPase | - |
QDY30_RS25465 (109818) | 109818..110234 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDY30_RS25470 (110231) | 110231..110461 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QDY30_RS25475 (110757) | 110757..111047 | + | 291 | WP_000111771.1 | hypothetical protein | - |
QDY30_RS25480 (111037) | 111037..111936 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
QDY30_RS25485 (111986) | 111986..114211 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
QDY30_RS25490 (114213) | 114213..115301 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / ant(3'')-Ia / dfrA1 / tet(A) | - | 1..136050 | 136050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T277260 WP_001044768.1 NZ_CP122589:c110234-109818 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |