Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4275164..4275714 Replicon chromosome
Accession NZ_CP122588
Organism Escherichia coli strain ETEC6335

Toxin (Protein)


Gene name ccdB Uniprot ID A0A788AHB0
Locus tag QDY30_RS20935 Protein ID WP_028132515.1
Coordinates 4275164..4275478 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QDY30_RS20940 Protein ID WP_000125566.1
Coordinates 4275481..4275714 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY30_RS20910 (4270839) 4270839..4272125 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QDY30_RS20915 (4272125) 4272125..4273114 + 990 WP_033814582.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QDY30_RS20920 (4273111) 4273111..4273932 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QDY30_RS20925 (4273935) 4273935..4274312 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QDY30_RS20930 (4274319) 4274319..4275167 + 849 WP_000257185.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QDY30_RS20935 (4275164) 4275164..4275478 - 315 WP_028132515.1 CcdB family protein Toxin
QDY30_RS20940 (4275481) 4275481..4275714 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QDY30_RS20945 (4275800) 4275800..4276279 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QDY30_RS20950 (4276471) 4276471..4278333 - 1863 WP_000377186.1 glutathione-regulated potassium-efflux system protein KefC -
QDY30_RS20955 (4278326) 4278326..4278856 - 531 WP_023307571.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QDY30_RS20960 (4278967) 4278967..4280298 - 1332 WP_023307570.1 MFS transporter -
QDY30_RS20965 (4280356) 4280356..4280643 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11694.82 Da        Isoelectric Point: 9.0855

>T277252 WP_028132515.1 NZ_CP122588:c4275478-4275164 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRILPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT277252 WP_000125566.1 NZ_CP122588:c4275714-4275481 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A788AHB0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References