Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3753861..3754479 | Replicon | chromosome |
Accession | NZ_CP122588 | ||
Organism | Escherichia coli strain ETEC6335 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDY30_RS18340 | Protein ID | WP_001291435.1 |
Coordinates | 3754261..3754479 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDY30_RS18335 | Protein ID | WP_000344800.1 |
Coordinates | 3753861..3754235 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY30_RS18325 (3748950) | 3748950..3750143 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDY30_RS18330 (3750166) | 3750166..3753315 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QDY30_RS18335 (3753861) | 3753861..3754235 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDY30_RS18340 (3754261) | 3754261..3754479 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDY30_RS18345 (3754651) | 3754651..3755202 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDY30_RS18350 (3755318) | 3755318..3755788 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDY30_RS18355 (3755952) | 3755952..3757502 | + | 1551 | WP_119457962.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDY30_RS18360 (3757544) | 3757544..3757897 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDY30_RS18370 (3758276) | 3758276..3758587 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDY30_RS18375 (3758618) | 3758618..3759190 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277249 WP_001291435.1 NZ_CP122588:3754261-3754479 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277249 WP_000344800.1 NZ_CP122588:3753861-3754235 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |